LOCUS       AK294595                1001 bp    mRNA    linear   HUM 24-JUL-2008
DEFINITION  Homo sapiens cDNA FLJ56781 complete cds.
ACCESSION   AK294595
VERSION     AK294595.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1001)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
            Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
            Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
            Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
  TITLE     NEDO human cDNA sequencing project focused on splicing variants
  JOURNAL   Unpublished (2007)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..1001
                     /clone="BRAWH2003207"
                     /clone_lib="BRAWH2"
                     /db_xref="H-InvDB:HIT000489219"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="brain"
     CDS             1..447
                     /codon_start=1
                     /protein_id="BAG57783.1"
                     /transl_table=1
                     /translation="MRGLPPAAGRVSREDLSFLHPLSGRRHRPGFGAGASGEVPVGAL
                     ERPLFLQGPRRRALRRPPYSAPSGRQYQPEAGYPRWARMPPLGPEHPPALPSQSHAEA
                     EVARGRPRLREKRRQRGLEDPGCGAPGRLAWVGLSPSRDWDSGVLV"
BASE COUNT          186 a          316 c          321 g          178 t
ORIGIN      
        1 atgcgcggtc tgcctcccgc ggcgggccgg gtctccaggg aggacctgag ttttcttcac
       61 ccattgtcag ggaggcgcca tcgccctggc tttggggctg gggcctccgg ggaggttccg
      121 gtaggggcgt tggagaggcc gctctttttg caaggcccga gacggcgggc cttgcgcagg
      181 ccgccctatt ccgcgccctc agggcgtcag tatcagcctg aggctggata cccccgctgg
      241 gcccggatgc ccccgctggg cccggagcat cctccggcgc tgccctccca gagccacgca
      301 gaggctgagg tggcgcgggg gcggccccgg ctccgcgaga agcggcggca gcgagggctg
      361 gaggacccgg gctgcggggc tccggggcgt ctggcctggg tgggactgag cccatccagg
      421 gactgggact ccggggttct ggtgtaggtg gatccggggc aggctcagga ccaagtccct
      481 ctccttccac caaggagcgc ccagaggccg gcgggagctc caggttcacc tcctcctcct
      541 ccagcttgac tacaacacaa atgaatccac tcaaatgttg gcaagtggag cagagtccca
      601 gaacaggtgc tgcagcagcc cggctggaag cgatgcagca tccaggacga cggaggaagg
      661 ggcagagagg gacctctgct ttccaggctg ccttttatac tgcctctggt cacctgacgt
      721 ggaacgtacc ctaacctaat cagttacatg aggcgcttgg aaaccaccgt caattggacc
      781 gcactgggaa acacagatga acaaagtcaa caccgctttg tccttcagtg cctggctcct
      841 ttttcagctc gtcttgcgac tccagaaact cctggagggc agaggcatgc ctgccatctt
      901 catcattgca ttaccaccac ccaacactat cgggggacct gccctgataa tcagtctaca
      961 ggtgtatcca gcagctccag agagacagcg accagcgaga a
//