LOCUS AK294595 1001 bp mRNA linear HUM 24-JUL-2008 DEFINITION Homo sapiens cDNA FLJ56781 complete cds. ACCESSION AK294595 VERSION AK294595.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1001) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K., Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y., Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M., Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T. TITLE NEDO human cDNA sequencing project focused on splicing variants JOURNAL Unpublished (2007) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..1001 /clone="BRAWH2003207" /clone_lib="BRAWH2" /db_xref="H-InvDB:HIT000489219" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /organism="Homo sapiens" /tissue_type="brain" CDS 1..447 /codon_start=1 /protein_id="BAG57783.1" /transl_table=1 /translation="MRGLPPAAGRVSREDLSFLHPLSGRRHRPGFGAGASGEVPVGAL ERPLFLQGPRRRALRRPPYSAPSGRQYQPEAGYPRWARMPPLGPEHPPALPSQSHAEA EVARGRPRLREKRRQRGLEDPGCGAPGRLAWVGLSPSRDWDSGVLV" BASE COUNT 186 a 316 c 321 g 178 t ORIGIN 1 atgcgcggtc tgcctcccgc ggcgggccgg gtctccaggg aggacctgag ttttcttcac 61 ccattgtcag ggaggcgcca tcgccctggc tttggggctg gggcctccgg ggaggttccg 121 gtaggggcgt tggagaggcc gctctttttg caaggcccga gacggcgggc cttgcgcagg 181 ccgccctatt ccgcgccctc agggcgtcag tatcagcctg aggctggata cccccgctgg 241 gcccggatgc ccccgctggg cccggagcat cctccggcgc tgccctccca gagccacgca 301 gaggctgagg tggcgcgggg gcggccccgg ctccgcgaga agcggcggca gcgagggctg 361 gaggacccgg gctgcggggc tccggggcgt ctggcctggg tgggactgag cccatccagg 421 gactgggact ccggggttct ggtgtaggtg gatccggggc aggctcagga ccaagtccct 481 ctccttccac caaggagcgc ccagaggccg gcgggagctc caggttcacc tcctcctcct 541 ccagcttgac tacaacacaa atgaatccac tcaaatgttg gcaagtggag cagagtccca 601 gaacaggtgc tgcagcagcc cggctggaag cgatgcagca tccaggacga cggaggaagg 661 ggcagagagg gacctctgct ttccaggctg ccttttatac tgcctctggt cacctgacgt 721 ggaacgtacc ctaacctaat cagttacatg aggcgcttgg aaaccaccgt caattggacc 781 gcactgggaa acacagatga acaaagtcaa caccgctttg tccttcagtg cctggctcct 841 ttttcagctc gtcttgcgac tccagaaact cctggagggc agaggcatgc ctgccatctt 901 catcattgca ttaccaccac ccaacactat cgggggacct gccctgataa tcagtctaca 961 ggtgtatcca gcagctccag agagacagcg accagcgaga a //