LOCUS       AK293558                 989 bp    mRNA    linear   HUM 21-JAN-2009
DEFINITION  Homo sapiens cDNA FLJ58447 complete cds, highly similar to
            Equilibrative nucleoside transporter 1.
ACCESSION   AK293558
VERSION     AK293558.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 989)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
            Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
            Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
            Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
  TITLE     NEDO human cDNA sequencing project focused on splicing variants
  JOURNAL   Unpublished (2007)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..989
                     /clone="BRACE2017842"
                     /clone_lib="BRACE2"
                     /db_xref="H-InvDB:HIT000488182"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="cerebellum"
     CDS             99..629
                     /codon_start=1
                     /note="highly similar to Equilibrative nucleoside
                     transporter 1"
                     /protein_id="BAH11534.1"
                     /transl_table=1
                     /translation="MTTSHQPQDRYKAVWLIFFMLGLGTLLPWNFFMTATQYFTNRLD
                     MSQNVSLVTAELSKDAQASAAPAAPLPERNSLSAIFNNVMTLCAMLPLLLFTYLNSFL
                     HQRIPQSVRILGSLVAILLVFLITAILVKVQLDALPFFVITMIKIVLINCKLGQEGAY
                     GRRHAQLPPLFFQTQR"
BASE COUNT          194 a          306 c          274 g          215 t
ORIGIN      
        1 agcgagagcg cgcggatctc agcgcgggag cagtgcttct gcggcaggcc cctgagggag
       61 ggagctgtca gccagggaaa accgagaaca ccatcaccat gacaaccagt caccagcctc
      121 aggacagata caaagctgtc tggcttatct tcttcatgct gggtctggga acgctgctcc
      181 cgtggaattt tttcatgacg gccactcagt atttcacaaa ccgcctggac atgtcccaga
      241 atgtgtcctt ggtcactgct gaactgagca aggacgccca ggcgtcagcc gcccctgcag
      301 cacccttgcc tgagcggaac tctctcagtg ccatcttcaa caatgtcatg accctatgtg
      361 ccatgctgcc cctgctgtta ttcacctacc tcaactcctt cctgcatcag aggatccccc
      421 agtccgtacg gatcctgggc agcctggtgg ccatcctgct ggtgtttctg atcactgcca
      481 tcctggtgaa ggtgcagctg gatgctctgc ccttctttgt catcaccatg atcaagatcg
      541 tgctcattaa ttgtaagctg ggccaggagg gggcctatgg gaggaggcat gcccaactac
      601 ccccactctt ttttcagacc cagcgttagc cagagagaag cccagcctcc gcctggaggg
      661 agtggatgct gtgagcagct gggattcaga ggcctgagtg ggcctggacc agggctggga
      721 gggggcagag agaagggcag ctcagcctca aggctcacca agagtaaagt aggaatgaca
      781 gggatctgtc ttcttgggca cccccaacca ccagccctag ctcccctgct catgcccgcc
      841 ctgtttcccc agcatttggt gccatcctgc agggcagcct gtttggtctg gctggccttc
      901 tgcctgccag ctacacggcc cccatcatga gtggccaggg cctagcaggc ttctttgcct
      961 ccgtggccat gatctgcgct attgccagt
//