LOCUS AK293558 989 bp mRNA linear HUM 21-JAN-2009 DEFINITION Homo sapiens cDNA FLJ58447 complete cds, highly similar to Equilibrative nucleoside transporter 1. ACCESSION AK293558 VERSION AK293558.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 989) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K., Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y., Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M., Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T. TITLE NEDO human cDNA sequencing project focused on splicing variants JOURNAL Unpublished (2007) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..989 /clone="BRACE2017842" /clone_lib="BRACE2" /db_xref="H-InvDB:HIT000488182" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /organism="Homo sapiens" /tissue_type="cerebellum" CDS 99..629 /codon_start=1 /note="highly similar to Equilibrative nucleoside transporter 1" /protein_id="BAH11534.1" /transl_table=1 /translation="MTTSHQPQDRYKAVWLIFFMLGLGTLLPWNFFMTATQYFTNRLD MSQNVSLVTAELSKDAQASAAPAAPLPERNSLSAIFNNVMTLCAMLPLLLFTYLNSFL HQRIPQSVRILGSLVAILLVFLITAILVKVQLDALPFFVITMIKIVLINCKLGQEGAY GRRHAQLPPLFFQTQR" BASE COUNT 194 a 306 c 274 g 215 t ORIGIN 1 agcgagagcg cgcggatctc agcgcgggag cagtgcttct gcggcaggcc cctgagggag 61 ggagctgtca gccagggaaa accgagaaca ccatcaccat gacaaccagt caccagcctc 121 aggacagata caaagctgtc tggcttatct tcttcatgct gggtctggga acgctgctcc 181 cgtggaattt tttcatgacg gccactcagt atttcacaaa ccgcctggac atgtcccaga 241 atgtgtcctt ggtcactgct gaactgagca aggacgccca ggcgtcagcc gcccctgcag 301 cacccttgcc tgagcggaac tctctcagtg ccatcttcaa caatgtcatg accctatgtg 361 ccatgctgcc cctgctgtta ttcacctacc tcaactcctt cctgcatcag aggatccccc 421 agtccgtacg gatcctgggc agcctggtgg ccatcctgct ggtgtttctg atcactgcca 481 tcctggtgaa ggtgcagctg gatgctctgc ccttctttgt catcaccatg atcaagatcg 541 tgctcattaa ttgtaagctg ggccaggagg gggcctatgg gaggaggcat gcccaactac 601 ccccactctt ttttcagacc cagcgttagc cagagagaag cccagcctcc gcctggaggg 661 agtggatgct gtgagcagct gggattcaga ggcctgagtg ggcctggacc agggctggga 721 gggggcagag agaagggcag ctcagcctca aggctcacca agagtaaagt aggaatgaca 781 gggatctgtc ttcttgggca cccccaacca ccagccctag ctcccctgct catgcccgcc 841 ctgtttcccc agcatttggt gccatcctgc agggcagcct gtttggtctg gctggccttc 901 tgcctgccag ctacacggcc cccatcatga gtggccaggg cctagcaggc ttctttgcct 961 ccgtggccat gatctgcgct attgccagt //