LOCUS AK291888 1096 bp mRNA linear HUM 09-JAN-2008
DEFINITION Homo sapiens cDNA FLJ78361 complete cds.
ACCESSION AK291888
VERSION AK291888.1
KEYWORDS FLI_CDNA; oligo capping.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1096)
AUTHORS Isogai,T. and Yamamoto,J.
TITLE Direct Submission
JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
Contact:Takao Isogai
Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
Chiyoda-ku, Tokyo 101-0044, Japan
E-mail :flj-cdna@nifty.com
REFERENCE 2
AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
TITLE NEDO human cDNA sequencing project
JOURNAL Unpublished (2007)
COMMENT Human cDNA sequencing project focused on splicing variants of mRNA
in NEDO functional analysis of protein and research application
project supported by Ministry of Economy, Trade and Industry,
Japan; cDNA selection for complete cds sequencing: Reverse
Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
(Hitachi) and Japan Biological Informatics Consortium, Japan
(JBIC); cDNA complete cds sequencing: JBIC; cDNA library
construction: Helix Research Institute supported by Japan Key
Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
Research Association for Biotechnology, Japan, Biotechnology
Center, National Institute of Technology and Evaluation, Japan and
HRI; cDNA mapping to human genome: Central Research Laboratory,
Hitachi; evaluation and annotation: REPRORI.
FEATURES Location/Qualifiers
source 1..1096
/clone="SKMUS2005119"
/clone_lib="SKMUS2"
/db_xref="H-InvDB:HIT000424685"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/organism="Homo sapiens"
/tissue_type="skeletal muscle"
CDS 756..1061
/codon_start=1
/protein_id="BAF84577.1"
/transl_table=1
/translation="MVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEAL
LRRLHLTPSQAAQLPLHLHLHRLLLPGTRARDTPVELLAPLPPYFSRTLQCLGLRLQ"
BASE COUNT 213 a 361 c 312 g 210 t
ORIGIN
1 gcacatgcgc gctgtcctgg ctcgggagat ggacggccgc cgtgttttgg gccggttctg
61 gagtggctgg cggcggggcc tgggtgtccg cccagtgccc gaggacgcag gctttggcac
121 cgaagcccgg catcagaggc aaccccgcgg ctcctgccaa cggtcggggc ccctcgggga
181 ccagcccttc gcggggctgc tgccaaaaaa acctcagtcg ggaggagctg gttgatgcgc
241 tgcgggcagc cgtggtggac cggaaaggac ctctagtgac gttgaacaag ccacagggtc
301 taccagtgac aggaaaacca ggagagctga cgttgttctc agtgctgcca gagctgagcc
361 agtccctagg gctcagggag caggagcttc aggttgtccg agcatctggg aaagaaagct
421 ctgggcttgt actcctctcc agctgtcccc agacagctag tcgcctccag aagtacttca
481 cccatgcacg gagagcccaa aggcccacag ccacctactg tgctgtcact gatgggatcc
541 cagctgcttc tgaggggaag atccaggctg ccctgaaact ggaacacatt gatggggtca
601 atctcacagt tccagtgaag gccccatccc gaaaggacat cctggaaggt gtcaagaaga
661 ctctcagtca ctttcgtgtg gtagccacag gctctggctg tgccctggtc cagctgcagc
721 cactgacagt gttctccagt caactacagg tgcacatggt actacagctc tgccctgtgc
781 ttggggacca catgtactct gcccgtgtgg gcactgtcct gggccagcga tttctgctgc
841 cagctgagaa caacaagccc caaagacagg tcctggatga agccctcctc agacgcctcc
901 acctgacccc ctcccaggct gcccagctgc ccttgcacct ccacctacat cggctccttc
961 tcccaggcac cagggccagg gacacccctg ttgagctcct ggcaccactg cccccttatt
1021 tctccaggac cctacagtgc ctggggctcc gcttacaata gtcctccctc tgttcctgac
1081 cccctcacac acactg
//