LOCUS AK291490 1280 bp mRNA linear HUM 09-JAN-2008 DEFINITION Homo sapiens cDNA FLJ77311 complete cds, highly similar to Homo sapiens cell division cycle associated 5 (CDCA5), mRNA. ACCESSION AK291490 VERSION AK291490.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1280) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K., Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y., Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M., Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T. TITLE NEDO human cDNA sequencing project JOURNAL Unpublished (2007) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..1280 /clone="OVARC1000100" /clone_lib="OVARC1" /db_xref="H-InvDB:HIT000424287" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /note="tumor tissue" /organism="Homo sapiens" /tissue_type="ovary, tumor tissue" CDS 90..848 /codon_start=1 /note="highly similar to Homo sapiens cell division cycle associated 5 (CDCA5), mRNA" /protein_id="BAF84179.1" /transl_table=1 /translation="MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEI WPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDL FKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTP GRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRK KKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE" BASE COUNT 253 a 377 c 388 g 262 t ORIGIN 1 aattcgaacg ttttttgcag cgagtggcct tcccggttgg cgcgcgcccg gggcggcggc 61 gctggaggag ctcgagacgg agcctagtta tgtctgggag gcgaacgcgg tccggaggag 121 ccgctcagcg ctccgggcca agggccccat ctcctactaa gcctctgcgg aggtcccagc 181 ggaaatcagg ctctgaactc ccgagcatcc tccctgaaat ctggccgaag acacccagtg 241 cggctgcagt cagaaagccc atcgtcttaa agaggatcgt ggcccatgct gtagaggtcc 301 cagctgtcca atcacctcgc aggagcccta ggatttcctt tttcttggag aaagaaaacg 361 agccccctgg cagggagctt actaaggagg accttttcaa gacacacagc gtccctgcca 421 cccccaccag cactcctgtg ccgaaccctg aggccgagtc cagctccaag gaaggagagc 481 tggacgccag agacttggaa atgtctaaga aagtcaggcg ttcctacagc cggctggaga 541 ccctgggctc tgcctctacc tccaccccag gccgccggtc ctgctttggc ttcgaggggc 601 tgctgggggc agaggacttg tccggagtct cgccagtggt gtgctccaaa ctcaccgagg 661 tccccagggt ttgtgcaaag ccctgggccc cagacatgac tctccctgga atctccccac 721 cacccgagaa acagaaacgt aagaagaaga aaatgccaga gatcttgaaa acggagctgg 781 atgagtgggc tgcggccatg aatgccgagt ttgaagctgc tgagcagttt gatctcctgg 841 ttgaatgaga tgcagtgggg ggtgcacctg gccagactct ccctcctgtc ctgtacatag 901 ccacctccct gtggagagga cacttagggt cccctcccct ggtcttgtta cctgtgtgtg 961 tgctggtgct gcgcatgagg actgtctgcc tttgagggct tgggcagcag cggcagccat 1021 cttggtttta ggaaatgggg ccgcctggcc cagccactca ctggtgtcct gtctcttgtc 1081 gtcctgtcct tcctatctcc ccaaagtacc atagccagtt tccagatggg ccacagactg 1141 gggaggagaa tcagtggccc agccagaagt taaagggctg agggttgagg tgagaggcac 1201 ctctgctctt gttgggaggg gtggctgctt ggaaataggc ccaggggctc tgccagcctc 1261 ggcctctccc tcctgagttg //