LOCUS       AK223332                 769 bp    mRNA    linear   HUM 17-NOV-2007
DEFINITION  Homo sapiens mRNA for CD27-binding (Siva) protein isoform 1
            variant, clone: TST00850.
ACCESSION   AK223332
VERSION     AK223332.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 769)
  AUTHORS   Suzuki,Y., Sugano,S., Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y.,
            Tanaka,A. and Yokoyama,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2005) to the DDBJ/EMBL/GenBank databases.
            Contact:Akiko Tanaka
            RIKEN Yokohama Institute, Protein Research Group; 1-7-22 Suehiro,
            Tsurumi, Yokohama, Kanagawa 230-0045, Japan
            URL    :http://protein.gsc.riken.jp/
REFERENCE   2
  AUTHORS   Maruyama,K. and Sugano,S.
  TITLE     Oligo-capping : a simple method to replace the cap structure of
            eucaryotic mRNAs with oligoribonucleotides.
  JOURNAL   Gene 138, 171-174 (1994)
REFERENCE   3
  AUTHORS   Suzuki,Y., Yoshitomo,K., Maruyama,K., Suyama,A. and Sugano,S.
  TITLE     Construction and characterization of a full length-enriched and a
            5'-end-enriched cDNA library.
  JOURNAL   Gene 200, 149-156 (1997)
COMMENT     This work was supported in part by the National Project on Protein
            Structural and Functional Analysis, Ministry of Education,
            Culture, Sports, Science and Technology of Japan.
            Sumio Sugano, Yutaka Suzuki
            Laboratory of Functional Genomics Department of Medical Genome
            Sciences Graduate School of Frontier Sciences The University of
            Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 Japan
            URL: http://www.k.u-tokyo.ac.jp/index.html.en
FEATURES             Location/Qualifiers
     source          1..769
                     /clone="TST00850"
                     /clone_lib="TST"
                     /db_xref="H-InvDB:HIT000331112"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /note="this clone is also named as hss001003973"
                     /organism="Homo sapiens"
                     /tissue_type="testis"
     CDS             <56..583
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Start codon is not identified."
                     /product="CD27-binding (Siva) protein isoform 1 variant"
                     /protein_id="BAD97052.1"
                     /translation="MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKR
                     LLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRGLGQAS
                     EADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSD
                     MYEKVLCTSCAMFET"
BASE COUNT          137 a          222 c          259 g          151 t
ORIGIN      
        1 gtcgttggta aggggctggc ggccggggag ctgcgtagct cccggccccg cggccatgcc
       61 caagcggagc tgccccttcg cggacgtggc cccgctacag ctcaaggtcc gcgtgagcca
      121 gagggagttg agccgcggcg tgtgcgccga gcgctactcg caggaggtct tcgagaagac
      181 caagcgactc ctgttcctcg gggcccaggc ctacctggac cacgtgtggg atgaaggctg
      241 tgccgtcgtt cacctgccag agtccccaaa gcctggccct acaggggccc cgagggctgc
      301 acgtgggcag atgctgattg gaccagacgg ccgcctgatc aggggccttg ggcaggcctc
      361 cgaagctgac ccatctgggg tagcgtccat tgcctgttcc tcatgcgtgc gagccgtgga
      421 tgggaaggcg gtctgcggtc agtgtgagcg agccctgtgc gggcagtgtg tgcgcacctg
      481 ctggggctgc ggctccgtgg cctgtaccct gtgtggcctc gtggactgca gtgacatgta
      541 cgagaaagtg ctgtgcacca gctgtgccat gttcgagacc tgaggctggc tcaagccggc
      601 tgccttcacc gggagccacg ccgtgcatgg cagccttccc tggacgagcg ctcggtgttc
      661 acactgaact gtggggtcga cgggaggggt gccttttaca tgttctattt tgtatcctaa
      721 tgacagaatg aataaacctc tttatatttg caaaaaaaaa aaaaaaaaa
//