LOCUS AK223332 769 bp mRNA linear HUM 17-NOV-2007 DEFINITION Homo sapiens mRNA for CD27-binding (Siva) protein isoform 1 variant, clone: TST00850. ACCESSION AK223332 VERSION AK223332.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 769) AUTHORS Suzuki,Y., Sugano,S., Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y., Tanaka,A. and Yokoyama,S. TITLE Direct Submission JOURNAL Submitted (22-APR-2005) to the DDBJ/EMBL/GenBank databases. Contact:Akiko Tanaka RIKEN Yokohama Institute, Protein Research Group; 1-7-22 Suehiro, Tsurumi, Yokohama, Kanagawa 230-0045, Japan URL :http://protein.gsc.riken.jp/ REFERENCE 2 AUTHORS Maruyama,K. and Sugano,S. TITLE Oligo-capping : a simple method to replace the cap structure of eucaryotic mRNAs with oligoribonucleotides. JOURNAL Gene 138, 171-174 (1994) REFERENCE 3 AUTHORS Suzuki,Y., Yoshitomo,K., Maruyama,K., Suyama,A. and Sugano,S. TITLE Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library. JOURNAL Gene 200, 149-156 (1997) COMMENT This work was supported in part by the National Project on Protein Structural and Functional Analysis, Ministry of Education, Culture, Sports, Science and Technology of Japan. Sumio Sugano, Yutaka Suzuki Laboratory of Functional Genomics Department of Medical Genome Sciences Graduate School of Frontier Sciences The University of Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 Japan URL: http://www.k.u-tokyo.ac.jp/index.html.en FEATURES Location/Qualifiers source 1..769 /clone="TST00850" /clone_lib="TST" /db_xref="H-InvDB:HIT000331112" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /note="this clone is also named as hss001003973" /organism="Homo sapiens" /tissue_type="testis" CDS <56..583 /codon_start=1 /inference="non-experimental evidence, no additional details recorded" /note="Start codon is not identified." /product="CD27-binding (Siva) protein isoform 1 variant" /protein_id="BAD97052.1" /translation="MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKR LLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRGLGQAS EADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSD MYEKVLCTSCAMFET" BASE COUNT 137 a 222 c 259 g 151 t ORIGIN 1 gtcgttggta aggggctggc ggccggggag ctgcgtagct cccggccccg cggccatgcc 61 caagcggagc tgccccttcg cggacgtggc cccgctacag ctcaaggtcc gcgtgagcca 121 gagggagttg agccgcggcg tgtgcgccga gcgctactcg caggaggtct tcgagaagac 181 caagcgactc ctgttcctcg gggcccaggc ctacctggac cacgtgtggg atgaaggctg 241 tgccgtcgtt cacctgccag agtccccaaa gcctggccct acaggggccc cgagggctgc 301 acgtgggcag atgctgattg gaccagacgg ccgcctgatc aggggccttg ggcaggcctc 361 cgaagctgac ccatctgggg tagcgtccat tgcctgttcc tcatgcgtgc gagccgtgga 421 tgggaaggcg gtctgcggtc agtgtgagcg agccctgtgc gggcagtgtg tgcgcacctg 481 ctggggctgc ggctccgtgg cctgtaccct gtgtggcctc gtggactgca gtgacatgta 541 cgagaaagtg ctgtgcacca gctgtgccat gttcgagacc tgaggctggc tcaagccggc 601 tgccttcacc gggagccacg ccgtgcatgg cagccttccc tggacgagcg ctcggtgttc 661 acactgaact gtggggtcga cgggaggggt gccttttaca tgttctattt tgtatcctaa 721 tgacagaatg aataaacctc tttatatttg caaaaaaaaa aaaaaaaaa //