LOCUS AK223124 911 bp mRNA linear HUM 17-NOV-2007 DEFINITION Homo sapiens mRNA for bone marrow stromal cell antigen 2 variant, clone: KAT11101. ACCESSION AK223124 VERSION AK223124.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 911) AUTHORS Suzuki,Y., Sugano,S., Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y., Tanaka,A. and Yokoyama,S. TITLE Direct Submission JOURNAL Submitted (22-APR-2005) to the DDBJ/EMBL/GenBank databases. Contact:Akiko Tanaka RIKEN Yokohama Institute, Protein Research Group; 1-7-22 Suehiro, Tsurumi, Yokohama, Kanagawa 230-0045, Japan URL :http://protein.gsc.riken.jp/ REFERENCE 2 AUTHORS Maruyama,K. and Sugano,S. TITLE Oligo-capping : a simple method to replace the cap structure of eucaryotic mRNAs with oligoribonucleotides. JOURNAL Gene 138, 171-174 (1994) REFERENCE 3 AUTHORS Suzuki,Y., Yoshitomo,K., Maruyama,K., Suyama,A. and Sugano,S. TITLE Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library. JOURNAL Gene 200, 149-156 (1997) COMMENT This work was supported in part by the National Project on Protein Structural and Functional Analysis, Ministry of Education, Culture, Sports, Science and Technology of Japan. Sumio Sugano, Yutaka Suzuki Laboratory of Functional Genomics Department of Medical Genome Sciences Graduate School of Frontier Sciences The University of Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 Japan URL: http://www.k.u-tokyo.ac.jp/index.html.en FEATURES Location/Qualifiers source 1..911 /cell_line="KATO III" /clone="KAT11101" /clone_lib="KAT" /db_xref="H-InvDB:HIT000330904" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /note="this clone is also named as hss001002815" /organism="Homo sapiens" CDS <20..562 /codon_start=1 /inference="non-experimental evidence, no additional details recorded" /note="Start codon is not identified." /product="bone marrow stromal cell antigen 2 variant" /protein_id="BAD96844.1" /translation="MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIF TIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASL DAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRREDQVLSVRIADKKYYPSSQDS SSAAAPQLLIVLLGLSALLQ" BASE COUNT 185 a 232 c 297 g 197 t ORIGIN 1 agctaaaggg gagatctgga tggcatctac ttcgtatgac tattgcagag tgcccatgga 61 agacggggat aagcgctgta aacttctgct ggggatagga attctggtgc tcctgatcat 121 cgtgattctg ggggtgccct tgattatctt caccatcaag gccaacagcg aggcctgccg 181 ggacggcctt cgggcagtga tggagtgtcg caatgtcacc catctcctgc aacaagagct 241 gaccgaggcc cagaagggct ttcaggatgt ggaggcccag gccgccacct gcaaccacac 301 tgtgatggcc ctaatggctt ccctggatgc agagaaggcc caaggacaaa agaaagtgga 361 ggagcttgag ggagagatca ctacattaaa ccataagctt caggacgcgt ctgcagaggt 421 ggagcgactg agaagagaag accaggtctt aagcgtgaga atcgcggaca agaagtacta 481 ccccagctcc caggactcca gctccgctgc ggcgccccag ctgctgattg tgctgctggg 541 cctcagcgct ctgctgcagt gagatcccag gaagctggca catcttggaa ggtccgtcct 601 gctcggcttt tcgcttgaac attcccttga tctcatcagt tctgagcggg tcatggggca 661 acacggttag cggggagagc acggggtagc cggagaaggg cctctggagc aggtctggag 721 gggccatggg gcagtcctgg gtgtggggac acagtcgggt tgacccaggg ctgtctccct 781 ccagaggctc cctccggaca atgagtcccc cctcttgtct cccaccctga gattgggcat 841 ggggtgcggt gtggggggca tgtgctgcct gttgttatgg gttttttttg cggggggggt 901 tgcttttttc t //