LOCUS       AK223124                 911 bp    mRNA    linear   HUM 17-NOV-2007
DEFINITION  Homo sapiens mRNA for bone marrow stromal cell antigen 2 variant,
            clone: KAT11101.
ACCESSION   AK223124
VERSION     AK223124.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 911)
  AUTHORS   Suzuki,Y., Sugano,S., Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y.,
            Tanaka,A. and Yokoyama,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2005) to the DDBJ/EMBL/GenBank databases.
            Contact:Akiko Tanaka
            RIKEN Yokohama Institute, Protein Research Group; 1-7-22 Suehiro,
            Tsurumi, Yokohama, Kanagawa 230-0045, Japan
            URL    :http://protein.gsc.riken.jp/
REFERENCE   2
  AUTHORS   Maruyama,K. and Sugano,S.
  TITLE     Oligo-capping : a simple method to replace the cap structure of
            eucaryotic mRNAs with oligoribonucleotides.
  JOURNAL   Gene 138, 171-174 (1994)
REFERENCE   3
  AUTHORS   Suzuki,Y., Yoshitomo,K., Maruyama,K., Suyama,A. and Sugano,S.
  TITLE     Construction and characterization of a full length-enriched and a
            5'-end-enriched cDNA library.
  JOURNAL   Gene 200, 149-156 (1997)
COMMENT     This work was supported in part by the National Project on Protein
            Structural and Functional Analysis, Ministry of Education,
            Culture, Sports, Science and Technology of Japan.
            Sumio Sugano, Yutaka Suzuki
            Laboratory of Functional Genomics Department of Medical Genome
            Sciences Graduate School of Frontier Sciences The University of
            Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 Japan
            URL: http://www.k.u-tokyo.ac.jp/index.html.en
FEATURES             Location/Qualifiers
     source          1..911
                     /cell_line="KATO III"
                     /clone="KAT11101"
                     /clone_lib="KAT"
                     /db_xref="H-InvDB:HIT000330904"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /note="this clone is also named as hss001002815"
                     /organism="Homo sapiens"
     CDS             <20..562
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Start codon is not identified."
                     /product="bone marrow stromal cell antigen 2 variant"
                     /protein_id="BAD96844.1"
                     /translation="MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIF
                     TIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASL
                     DAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRREDQVLSVRIADKKYYPSSQDS
                     SSAAAPQLLIVLLGLSALLQ"
BASE COUNT          185 a          232 c          297 g          197 t
ORIGIN      
        1 agctaaaggg gagatctgga tggcatctac ttcgtatgac tattgcagag tgcccatgga
       61 agacggggat aagcgctgta aacttctgct ggggatagga attctggtgc tcctgatcat
      121 cgtgattctg ggggtgccct tgattatctt caccatcaag gccaacagcg aggcctgccg
      181 ggacggcctt cgggcagtga tggagtgtcg caatgtcacc catctcctgc aacaagagct
      241 gaccgaggcc cagaagggct ttcaggatgt ggaggcccag gccgccacct gcaaccacac
      301 tgtgatggcc ctaatggctt ccctggatgc agagaaggcc caaggacaaa agaaagtgga
      361 ggagcttgag ggagagatca ctacattaaa ccataagctt caggacgcgt ctgcagaggt
      421 ggagcgactg agaagagaag accaggtctt aagcgtgaga atcgcggaca agaagtacta
      481 ccccagctcc caggactcca gctccgctgc ggcgccccag ctgctgattg tgctgctggg
      541 cctcagcgct ctgctgcagt gagatcccag gaagctggca catcttggaa ggtccgtcct
      601 gctcggcttt tcgcttgaac attcccttga tctcatcagt tctgagcggg tcatggggca
      661 acacggttag cggggagagc acggggtagc cggagaaggg cctctggagc aggtctggag
      721 gggccatggg gcagtcctgg gtgtggggac acagtcgggt tgacccaggg ctgtctccct
      781 ccagaggctc cctccggaca atgagtcccc cctcttgtct cccaccctga gattgggcat
      841 ggggtgcggt gtggggggca tgtgctgcct gttgttatgg gttttttttg cggggggggt
      901 tgcttttttc t
//