LOCUS       AK222978                 638 bp    mRNA    linear   HUM 17-NOV-2007
DEFINITION  Homo sapiens mRNA for PEST-containing nuclear protein variant,
            clone: HSI03937.
ACCESSION   AK222978
VERSION     AK222978.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 638)
  AUTHORS   Suzuki,Y., Sugano,S., Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y.,
            Tanaka,A. and Yokoyama,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2005) to the DDBJ/EMBL/GenBank databases.
            Contact:Akiko Tanaka
            RIKEN Yokohama Institute, Protein Research Group; 1-7-22 Suehiro,
            Tsurumi, Yokohama, Kanagawa 230-0045, Japan
            URL    :http://protein.gsc.riken.jp/
REFERENCE   2
  AUTHORS   Maruyama,K. and Sugano,S.
  TITLE     Oligo-capping : a simple method to replace the cap structure of
            eucaryotic mRNAs with oligoribonucleotides.
  JOURNAL   Gene 138, 171-174 (1994)
REFERENCE   3
  AUTHORS   Suzuki,Y., Yoshitomo,K., Maruyama,K., Suyama,A. and Sugano,S.
  TITLE     Construction and characterization of a full length-enriched and a
            5'-end-enriched cDNA library.
  JOURNAL   Gene 200, 149-156 (1997)
COMMENT     This work was supported in part by the National Project on Protein
            Structural and Functional Analysis, Ministry of Education,
            Culture, Sports, Science and Technology of Japan.
            Sumio Sugano, Yutaka Suzuki
            Laboratory of Functional Genomics Department of Medical Genome
            Sciences Graduate School of Frontier Sciences The University of
            Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 Japan
            URL: http://www.k.u-tokyo.ac.jp/index.html.en
FEATURES             Location/Qualifiers
     source          1..638
                     /clone="HSI03937"
                     /clone_lib="HSI"
                     /db_xref="H-InvDB:HIT000330758"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /note="this clone is also named as hss001002200"
                     /organism="Homo sapiens"
                     /tissue_type="human small intestine"
     CDS             <14..550
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Start codon is not identified."
                     /product="PEST-containing nuclear protein variant"
                     /protein_id="BAD96698.1"
                     /translation="MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGES
                     SSRSAEKRSAEEEAADLPTKPTKISKFGFAIGSQTTKKASAISIKLGSSKPKETVPTL
                     APKTLSVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNEGKHGFSDNQK
                     LWERNIKSHLGNVHDQDN"
BASE COUNT          221 a          119 c          166 g          132 t
ORIGIN      
        1 cgcggcgggg aaaatggcgg acgggaaggc gggagacgag aagcctgaaa agtcgcagcg
       61 agctggagcc gccggaggac ctgaagaaga agcagaaaaa cctgtgaaaa ctaagactgt
      121 ttcttccagt aatggagggg aaagttccag tcgcagcgct gagaagcgat cagctgaaga
      181 agaagctgcc gacctcccaa caaagcctac aaagatctcc aagtttggat ttgccatagg
      241 tagtcagacg acaaagaaag catcagccat atccatcaaa cttggatcaa gtaaacctaa
      301 agaaactgtt ccaactcttg ctccaaaaac tctttcagta gcagcagctt ttaatgaaga
      361 tgaagatagt gaaccagagg aaatgcctcc agaagcaaag atgaggatga agaatattgg
      421 aagggataca ccaacatcag ctggaccaaa ctccttcaat gaaggaaagc atgggttttc
      481 tgataaccag aagctgtggg agcgaaatat aaaatctcat cttggaaatg tccatgacca
      541 agacaattaa atgatgtttt gaaattgggg tgtggggtgg gtgtaaagtt aaaaggaaca
      601 gtttcctttt ttaaagaatg gtataagact atctttgg
//