LOCUS AK222978 638 bp mRNA linear HUM 17-NOV-2007 DEFINITION Homo sapiens mRNA for PEST-containing nuclear protein variant, clone: HSI03937. ACCESSION AK222978 VERSION AK222978.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 638) AUTHORS Suzuki,Y., Sugano,S., Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y., Tanaka,A. and Yokoyama,S. TITLE Direct Submission JOURNAL Submitted (22-APR-2005) to the DDBJ/EMBL/GenBank databases. Contact:Akiko Tanaka RIKEN Yokohama Institute, Protein Research Group; 1-7-22 Suehiro, Tsurumi, Yokohama, Kanagawa 230-0045, Japan URL :http://protein.gsc.riken.jp/ REFERENCE 2 AUTHORS Maruyama,K. and Sugano,S. TITLE Oligo-capping : a simple method to replace the cap structure of eucaryotic mRNAs with oligoribonucleotides. JOURNAL Gene 138, 171-174 (1994) REFERENCE 3 AUTHORS Suzuki,Y., Yoshitomo,K., Maruyama,K., Suyama,A. and Sugano,S. TITLE Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library. JOURNAL Gene 200, 149-156 (1997) COMMENT This work was supported in part by the National Project on Protein Structural and Functional Analysis, Ministry of Education, Culture, Sports, Science and Technology of Japan. Sumio Sugano, Yutaka Suzuki Laboratory of Functional Genomics Department of Medical Genome Sciences Graduate School of Frontier Sciences The University of Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 Japan URL: http://www.k.u-tokyo.ac.jp/index.html.en FEATURES Location/Qualifiers source 1..638 /clone="HSI03937" /clone_lib="HSI" /db_xref="H-InvDB:HIT000330758" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /note="this clone is also named as hss001002200" /organism="Homo sapiens" /tissue_type="human small intestine" CDS <14..550 /codon_start=1 /inference="non-experimental evidence, no additional details recorded" /note="Start codon is not identified." /product="PEST-containing nuclear protein variant" /protein_id="BAD96698.1" /translation="MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGES SSRSAEKRSAEEEAADLPTKPTKISKFGFAIGSQTTKKASAISIKLGSSKPKETVPTL APKTLSVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNEGKHGFSDNQK LWERNIKSHLGNVHDQDN" BASE COUNT 221 a 119 c 166 g 132 t ORIGIN 1 cgcggcgggg aaaatggcgg acgggaaggc gggagacgag aagcctgaaa agtcgcagcg 61 agctggagcc gccggaggac ctgaagaaga agcagaaaaa cctgtgaaaa ctaagactgt 121 ttcttccagt aatggagggg aaagttccag tcgcagcgct gagaagcgat cagctgaaga 181 agaagctgcc gacctcccaa caaagcctac aaagatctcc aagtttggat ttgccatagg 241 tagtcagacg acaaagaaag catcagccat atccatcaaa cttggatcaa gtaaacctaa 301 agaaactgtt ccaactcttg ctccaaaaac tctttcagta gcagcagctt ttaatgaaga 361 tgaagatagt gaaccagagg aaatgcctcc agaagcaaag atgaggatga agaatattgg 421 aagggataca ccaacatcag ctggaccaaa ctccttcaat gaaggaaagc atgggttttc 481 tgataaccag aagctgtggg agcgaaatat aaaatctcat cttggaaatg tccatgacca 541 agacaattaa atgatgtttt gaaattgggg tgtggggtgg gtgtaaagtt aaaaggaaca 601 gtttcctttt ttaaagaatg gtataagact atctttgg //