LOCUS       AK222634                 499 bp    mRNA    linear   HUM 17-NOV-2007
DEFINITION  Homo sapiens mRNA for HSPC163 protein variant, clone: CBL02841.
ACCESSION   AK222634
VERSION     AK222634.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 499)
  AUTHORS   Suzuki,Y., Sugano,S., Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y.,
            Tanaka,A. and Yokoyama,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2005) to the DDBJ/EMBL/GenBank databases.
            Contact:Akiko Tanaka
            RIKEN Yokohama Institute, Protein Research Group; 1-7-22 Suehiro,
            Tsurumi, Yokohama, Kanagawa 230-0045, Japan
            URL    :http://protein.gsc.riken.jp/
REFERENCE   2
  AUTHORS   Maruyama,K. and Sugano,S.
  TITLE     Oligo-capping : a simple method to replace the cap structure of
            eucaryotic mRNAs with oligoribonucleotides.
  JOURNAL   Gene 138, 171-174 (1994)
REFERENCE   3
  AUTHORS   Suzuki,Y., Yoshitomo,K., Maruyama,K., Suyama,A. and Sugano,S.
  TITLE     Construction and characterization of a full length-enriched and a
            5'-end-enriched cDNA library.
  JOURNAL   Gene 200, 149-156 (1997)
COMMENT     This work was supported in part by the National Project on Protein
            Structural and Functional Analysis, Ministry of Education,
            Culture, Sports, Science and Technology of Japan.
            Sumio Sugano, Yutaka Suzuki
            Laboratory of Functional Genomics Department of Medical Genome
            Sciences Graduate School of Frontier Sciences The University of
            Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 Japan
            URL: http://www.k.u-tokyo.ac.jp/index.html.en
FEATURES             Location/Qualifiers
     source          1..499
                     /clone="CBL02841"
                     /clone_lib="CBL"
                     /db_xref="H-InvDB:HIT000330414"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /note="this clone is also named as hss001000635"
                     /organism="Homo sapiens"
                     /tissue_type="cerebellum"
     CDS             <20..439
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Start codon is not identified."
                     /product="HSPC163 protein variant"
                     /protein_id="BAD96354.1"
                     /translation="MEAVVFVFSLLGCCALIFLSVYFIITLSDLECDYINARSCCSKL
                     NKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIH
                     NRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALVND"
BASE COUNT          125 a          103 c          117 g          154 t
ORIGIN      
        1 gcggcgacgg aggaggagga tggaggcggt ggtgttcgtc ttctctctcc tcggttgttg
       61 cgcgctcatc ttcctctcgg tctacttcat aattacattg tctgatttag aatgtgatta
      121 cattaatgct agatcatgtt gctcaaaatt aaacaagtgg gtaattccag aattgattgg
      181 ccataccatt gtcactgtat tactgctcat gtcattgcac tggttcatct tccttctcaa
      241 cttacctgtt gccacttgga atatatatcg atacattatg gtgccgagtg gtaacatggg
      301 agtgtttgat ccaacagaaa tacacaatcg agggcagctg aagtcacaca tgaaagaagc
      361 catgatcaag cttggtttcc acttgctctg cttcttcatg tatctttata gtatgatctt
      421 agctttggta aatgactgaa gctggagaag ccgtggttga agtcagccta cactacagtg
      481 cacagttgag gagccagag
//