LOCUS AK222634 499 bp mRNA linear HUM 17-NOV-2007 DEFINITION Homo sapiens mRNA for HSPC163 protein variant, clone: CBL02841. ACCESSION AK222634 VERSION AK222634.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 499) AUTHORS Suzuki,Y., Sugano,S., Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y., Tanaka,A. and Yokoyama,S. TITLE Direct Submission JOURNAL Submitted (22-APR-2005) to the DDBJ/EMBL/GenBank databases. Contact:Akiko Tanaka RIKEN Yokohama Institute, Protein Research Group; 1-7-22 Suehiro, Tsurumi, Yokohama, Kanagawa 230-0045, Japan URL :http://protein.gsc.riken.jp/ REFERENCE 2 AUTHORS Maruyama,K. and Sugano,S. TITLE Oligo-capping : a simple method to replace the cap structure of eucaryotic mRNAs with oligoribonucleotides. JOURNAL Gene 138, 171-174 (1994) REFERENCE 3 AUTHORS Suzuki,Y., Yoshitomo,K., Maruyama,K., Suyama,A. and Sugano,S. TITLE Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library. JOURNAL Gene 200, 149-156 (1997) COMMENT This work was supported in part by the National Project on Protein Structural and Functional Analysis, Ministry of Education, Culture, Sports, Science and Technology of Japan. Sumio Sugano, Yutaka Suzuki Laboratory of Functional Genomics Department of Medical Genome Sciences Graduate School of Frontier Sciences The University of Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 Japan URL: http://www.k.u-tokyo.ac.jp/index.html.en FEATURES Location/Qualifiers source 1..499 /clone="CBL02841" /clone_lib="CBL" /db_xref="H-InvDB:HIT000330414" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /note="this clone is also named as hss001000635" /organism="Homo sapiens" /tissue_type="cerebellum" CDS <20..439 /codon_start=1 /inference="non-experimental evidence, no additional details recorded" /note="Start codon is not identified." /product="HSPC163 protein variant" /protein_id="BAD96354.1" /translation="MEAVVFVFSLLGCCALIFLSVYFIITLSDLECDYINARSCCSKL NKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIH NRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALVND" BASE COUNT 125 a 103 c 117 g 154 t ORIGIN 1 gcggcgacgg aggaggagga tggaggcggt ggtgttcgtc ttctctctcc tcggttgttg 61 cgcgctcatc ttcctctcgg tctacttcat aattacattg tctgatttag aatgtgatta 121 cattaatgct agatcatgtt gctcaaaatt aaacaagtgg gtaattccag aattgattgg 181 ccataccatt gtcactgtat tactgctcat gtcattgcac tggttcatct tccttctcaa 241 cttacctgtt gccacttgga atatatatcg atacattatg gtgccgagtg gtaacatggg 301 agtgtttgat ccaacagaaa tacacaatcg agggcagctg aagtcacaca tgaaagaagc 361 catgatcaag cttggtttcc acttgctctg cttcttcatg tatctttata gtatgatctt 421 agctttggta aatgactgaa gctggagaag ccgtggttga agtcagccta cactacagtg 481 cacagttgag gagccagag //