LOCUS       AK222594                 967 bp    mRNA    linear   HUM 17-NOV-2007
DEFINITION  Homo sapiens mRNA for ribosomal protein S4, Y-linked 1 Y isoform
            variant, clone: CAS09424.
ACCESSION   AK222594
VERSION     AK222594.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 967)
  AUTHORS   Suzuki,Y., Sugano,S., Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y.,
            Tanaka,A. and Yokoyama,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2005) to the DDBJ/EMBL/GenBank databases.
            Contact:Akiko Tanaka
            RIKEN Yokohama Institute, Protein Research Group; 1-7-22 Suehiro,
            Tsurumi, Yokohama, Kanagawa 230-0045, Japan
            URL    :http://protein.gsc.riken.jp/
REFERENCE   2
  AUTHORS   Maruyama,K. and Sugano,S.
  TITLE     Oligo-capping : a simple method to replace the cap structure of
            eucaryotic mRNAs with oligoribonucleotides.
  JOURNAL   Gene 138, 171-174 (1994)
REFERENCE   3
  AUTHORS   Suzuki,Y., Yoshitomo,K., Maruyama,K., Suyama,A. and Sugano,S.
  TITLE     Construction and characterization of a full length-enriched and a
            5'-end-enriched cDNA library.
  JOURNAL   Gene 200, 149-156 (1997)
COMMENT     This work was supported in part by the National Project on Protein
            Structural and Functional Analysis, Ministry of Education,
            Culture, Sports, Science and Technology of Japan.
            Sumio Sugano, Yutaka Suzuki
            Laboratory of Functional Genomics Department of Medical Genome
            Sciences Graduate School of Frontier Sciences The University of
            Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 Japan
            URL: http://www.k.u-tokyo.ac.jp/index.html.en
FEATURES             Location/Qualifiers
     source          1..967
                     /cell_type="primary smooth muscle cells of human coronary
                     artery"
                     /clone="CAS09424"
                     /clone_lib="CAS"
                     /db_xref="H-InvDB:HIT000330374"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /note="this clone is also named as hss001000438"
                     /organism="Homo sapiens"
                     /tissue_type="coronary artery"
     CDS             <25..816
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Start codon is not identified."
                     /product="ribosomal protein S4, Y-linked 1 Y isoform
                     variant"
                     /protein_id="BAD96314.1"
                     /translation="MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPL
                     IVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLV
                     YDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTV
                     QIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFGVVHVKDANGNSF
                     ATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG"
BASE COUNT          326 a          188 c          227 g          226 t
ORIGIN      
        1 tctcttccgt cgcagagttt cgccatggcc cggggcccca agaagcactt aaagcgtgtt
       61 gcagcgccga agcattggat gcttgacaaa ctaacgggtg tatttgcacc tcgtccatcg
      121 acaggtcccc acaagctgag ggaatgtctt cctctgatcg tcttcctcag gaatagactc
      181 aagtatgcgt tgactggaga tgaggtaaag aagatatgta tgcaacgttt catcaaaatt
      241 gatggcaagg ttcgagtgga tgtcacatac cctgctggat tcatggatgt catcagcatc
      301 gagaagacag gtgaacattt ccgcctggtc tatgacacca agggccgttt tgctgttcac
      361 cgcatcacag tggaagaggc aaagtacaag ttgtgcaaag tgaggaagat tactgtggga
      421 gtgaagggaa tccctcacct ggtgactcat gatgctcgaa ccatccgcta cccagatcct
      481 gtcatcaagg tgaacgatac tgtgcagatt gatttaggga ctggcaagat aatcaacttt
      541 atcaaatttg atacaggcaa tttgtgtatg gtgattggtg gagccaacct cggtcgtgtt
      601 ggtgtgatca ccaacaggga aagacatcct ggttcttttg gtgtggtgca tgtgaaggat
      661 gccaatggca acagctttgc cacgaggctt tccaacattt ttgtcattgg caatggcaat
      721 aaaccttgga tttccctgcc caggggaaag ggcattcgac ttactgttgc tgaagagaga
      781 gataagaggc tggccaccaa acagagcagt ggctaaattg cagtagcagc atatcttttt
      841 ttctttgcac aaataaacag tgaattctcg ttaaaaaaaa aaaaaaaaaa aaaaaaaaaa
      901 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
      961 aaaaaaa
//