LOCUS AK222594 967 bp mRNA linear HUM 17-NOV-2007 DEFINITION Homo sapiens mRNA for ribosomal protein S4, Y-linked 1 Y isoform variant, clone: CAS09424. ACCESSION AK222594 VERSION AK222594.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 967) AUTHORS Suzuki,Y., Sugano,S., Totoki,Y., Toyoda,A., Takeda,T., Sakaki,Y., Tanaka,A. and Yokoyama,S. TITLE Direct Submission JOURNAL Submitted (22-APR-2005) to the DDBJ/EMBL/GenBank databases. Contact:Akiko Tanaka RIKEN Yokohama Institute, Protein Research Group; 1-7-22 Suehiro, Tsurumi, Yokohama, Kanagawa 230-0045, Japan URL :http://protein.gsc.riken.jp/ REFERENCE 2 AUTHORS Maruyama,K. and Sugano,S. TITLE Oligo-capping : a simple method to replace the cap structure of eucaryotic mRNAs with oligoribonucleotides. JOURNAL Gene 138, 171-174 (1994) REFERENCE 3 AUTHORS Suzuki,Y., Yoshitomo,K., Maruyama,K., Suyama,A. and Sugano,S. TITLE Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library. JOURNAL Gene 200, 149-156 (1997) COMMENT This work was supported in part by the National Project on Protein Structural and Functional Analysis, Ministry of Education, Culture, Sports, Science and Technology of Japan. Sumio Sugano, Yutaka Suzuki Laboratory of Functional Genomics Department of Medical Genome Sciences Graduate School of Frontier Sciences The University of Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 Japan URL: http://www.k.u-tokyo.ac.jp/index.html.en FEATURES Location/Qualifiers source 1..967 /cell_type="primary smooth muscle cells of human coronary artery" /clone="CAS09424" /clone_lib="CAS" /db_xref="H-InvDB:HIT000330374" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /note="this clone is also named as hss001000438" /organism="Homo sapiens" /tissue_type="coronary artery" CDS <25..816 /codon_start=1 /inference="non-experimental evidence, no additional details recorded" /note="Start codon is not identified." /product="ribosomal protein S4, Y-linked 1 Y isoform variant" /protein_id="BAD96314.1" /translation="MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPL IVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLV YDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTV QIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFGVVHVKDANGNSF ATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG" BASE COUNT 326 a 188 c 227 g 226 t ORIGIN 1 tctcttccgt cgcagagttt cgccatggcc cggggcccca agaagcactt aaagcgtgtt 61 gcagcgccga agcattggat gcttgacaaa ctaacgggtg tatttgcacc tcgtccatcg 121 acaggtcccc acaagctgag ggaatgtctt cctctgatcg tcttcctcag gaatagactc 181 aagtatgcgt tgactggaga tgaggtaaag aagatatgta tgcaacgttt catcaaaatt 241 gatggcaagg ttcgagtgga tgtcacatac cctgctggat tcatggatgt catcagcatc 301 gagaagacag gtgaacattt ccgcctggtc tatgacacca agggccgttt tgctgttcac 361 cgcatcacag tggaagaggc aaagtacaag ttgtgcaaag tgaggaagat tactgtggga 421 gtgaagggaa tccctcacct ggtgactcat gatgctcgaa ccatccgcta cccagatcct 481 gtcatcaagg tgaacgatac tgtgcagatt gatttaggga ctggcaagat aatcaacttt 541 atcaaatttg atacaggcaa tttgtgtatg gtgattggtg gagccaacct cggtcgtgtt 601 ggtgtgatca ccaacaggga aagacatcct ggttcttttg gtgtggtgca tgtgaaggat 661 gccaatggca acagctttgc cacgaggctt tccaacattt ttgtcattgg caatggcaat 721 aaaccttgga tttccctgcc caggggaaag ggcattcgac ttactgttgc tgaagagaga 781 gataagaggc tggccaccaa acagagcagt ggctaaattg cagtagcagc atatcttttt 841 ttctttgcac aaataaacag tgaattctcg ttaaaaaaaa aaaaaaaaaa aaaaaaaaaa 901 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa 961 aaaaaaa //