LOCUS AK131943 1605 bp mRNA linear HTC 06-OCT-2010 DEFINITION Mus musculus ES cells cDNA, RIKEN full-length enriched library, clone:2410018B15 product:left-right determination, factor B, full insert sequence. ACCESSION AK131943 VERSION AK131943.1 KEYWORDS HTC_FLI; HTC; CAP trapper. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1605) AUTHORS Arakawa,T., Carninci,P., Fukuda,S., Hashizume,W., Hayashida,K., Hori,F., Iida,J., Imamura,K., Imotani,K., Itoh,M., Kanagawa,S., Kawai,J., Kojima,M., Konno,H., Murata,M., Nakamura,M., Ninomiya,N., Nishiyori,H., Nomura,K., Ohno,M., Sakazume,N., Sano,H., Sasaki,D., Shibata,K., Shiraki,T., Tagami,M., Tagami,Y., Waki,K., Watahiki,A., Muramatsu,M. and Hayashizaki,Y. TITLE Direct Submission JOURNAL Submitted (30-MAR-2004) to the DDBJ/EMBL/GenBank databases. Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22 Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL :http://www.osc.riken.jp/ REFERENCE 2 AUTHORS CONSRTM The FANTOM Consortium, Riken Genome Exploration Research Group and Genome Science Group (Genome Network Project Core Group) TITLE The Transcriptional Landscape of the Mammalian Genome JOURNAL Science 309, 1559-1563 (2005) REFERENCE 3 AUTHORS CONSRTM RIKEN Genome Exploration Research Group and Genome Science Group (Genome Network Project Core Group) and the FANTOM Consortium TITLE Antisense Transcription in the Mammalian Transcriptome JOURNAL Science 309, 1564-1566 (2005) REFERENCE 4 AUTHORS CONSRTM The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase I and II Team TITLE Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs JOURNAL Nature 420, 563-573 (2002) REFERENCE 5 AUTHORS CONSRTM The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM Consortium TITLE Functional annotation of a full-length mouse cDNA collection JOURNAL Nature 409, 685-690 (2001) REFERENCE 6 AUTHORS Carninci,P. and Hayashizaki,Y. TITLE High-efficiency full-length cDNA cloning JOURNAL Meth. Enzymol. 303, 19-44 (1999) REFERENCE 7 AUTHORS Carninci,P., Shibata,Y., Hayatsu,N., Sugahara,Y., Shibata,K., Itoh,M., Konno,H., Okazaki,Y., Muramatsu,M. and Hayashizaki,Y. TITLE Normalization and subtraction of cap-trapper-selected cDNAs to prepare full-length cDNA libraries for rapid discovery of new genes JOURNAL Genome Res. 10, 1617-1630 (2000) REFERENCE 8 AUTHORS Shibata,K., Itoh,M., Aizawa,K., Nagaoka,S., Sasaki,N., Carninci,P., Konno,H., Akiyama,J., Nishi,K., Kitsunai,T., Tashiro,H., Itoh,M., Sumi,N., Ishii,Y., Nakamura,S., Hazama,M., Nishine,T., Harada,A., Yamamoto,R., Matsumoto,H., Sakaguchi,S., Ikegami,T., Kashiwagi,K., Fujiwake,S., Inoue,K., Togawa,Y., Izawa,M., Ohara,E., Watahiki,M., Yoneda,Y., Ishikawa,T., Ozawa,K., Tanaka,T., Matsuura,S., Kawai,J., Okazaki,Y., Muramatsu,M., Inoue,Y., Kira,A. and Hayashizaki,Y. TITLE RIKEN integrated sequence analysis (RISA) system-384-format sequencing pipeline with 384 multicapillary sequencer JOURNAL Genome Res. 10, 1757-1771 (2000) COMMENT cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science Laboratory in RIKEN. Division of Experimental Animal Research in Riken contributed to prepare mouse tissues. Please visit our web site for further details. URL:http://www.osc.riken.jp/ URL:http://fantom.gsc.riken.jp/ clone information is available at: http://fantom.gsc.riken.jp/3/db/annotate/ main.cgi?masterid=2410018B15 FEATURES Location/Qualifiers source 1..1605 /cell_type="ES cells" /clone="2410018B15" /clone_lib="RIKEN full-length enriched mouse cDNA library" /db_xref="FANTOM_DB:2410018B15" /db_xref="MGI:3532224" /db_xref="taxon:10090" /mol_type="mRNA" /organism="Mus musculus" /strain="C57BL/6J" CDS 74..1180 /codon_start=1 /note="left-right determination, factor B (MGD|MGI:107405 GB|Z73151, evidence: BLASTN, 100%, match=1583)" /note="putative" /protein_id="BAE20889.1" /transl_table=1 /translation="MPFLWLCWALWALSLVSLREALTGEQILGSLLQQLQLDQPPVLD KADVEGMVIPSHVRTQYVALLQHSHASRSRGKRFSQNLREVAGRFLVSETSTHLLVFG MEQRLPPNSELVQAVLRLFQEPVPRTALRRQKRLSPHSARARVTIEWLRFRDDGSNRT ALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSSHKL VRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEAPVTEGTRCCRQEMYLDLQG MKWAENWILEPPGFLTYECVGSCLQLPESLTSRWPFLGPRQCVASEMTSLPMIVSVKE GGRTRPQVVSLPNMRVQTCSCASDGALIPRRLQP" regulatory 1584..1589 /note="putative" /regulatory_class="polyA_signal_sequence" polyA_site 1605 /note="putative" BASE COUNT 332 a 463 c 479 g 331 t ORIGIN 1 ggcgcagact caagaccctt tcaggacacc tcagggacac acacatccaa ggctcctctt 61 cccggacagc accatgccat tcctgtggct ctgctgggca ctctgggcac tgtcgctggt 121 tagcctcagg gaagccctga ccggagagca gatcctgggc agcctgctgc aacagctgca 181 gctcgatcaa ccgccagtcc tggacaaggc tgatgtggaa gggatggtca tcccctcgca 241 cgtgaggact cagtatgtgg ccctgctaca acacagccat gccagccgct cccgaggcaa 301 gaggttcagc cagaaccttc gagaggtggc aggcaggttc ctggtgtcag agacctccac 361 tcacctgcta gtgttcggaa tggagcagcg gctgccgcct aacagcgagc tggtgcaggc 421 tgtgctgcgg ctgttccagg agcctgtgcc cagaacagct ctccggaggc aaaagaggct 481 gtccccacac agtgcccggg ctcgggtcac cattgaatgg ctgcgcttcc gcgacgacgg 541 ctccaaccgc actgccctta tcgattctag gctcgtgtcc atccacgaga gcggctggaa 601 ggccttcgac gtgaccgagg ccgtgaactt ctggcagcag ctgagccggc cgaggcagcc 661 gctgctgctc caggtgtcgg tgcagaggga gcatctgggg ccgggaacct ggagctcaca 721 caagttggtt cgtttcgcgg cgcaggggac gccggatggc aaggggcagg gcgagccaca 781 gctggagctg cacacgctgg acctcaagga ctatggagct caaggcaatt gtgaccccga 841 ggcaccagtg actgaaggca cccgatgctg tcgccaggag atgtacctgg acctgcaggg 901 gatgaagtgg gccgagaact ggatcctaga accgccaggg ttcctgacat atgaatgtgt 961 gggcagctgc ctgcagctac cggagtccct gaccagcagg tggccatttc tggggcctcg 1021 gcagtgtgtc gcctcagaga tgacctccct gcccatgatt gtcagcgtga aggagggagg 1081 caggaccagg cctcaagtgg tcagcctgcc caacatgagg gtgcagacct gtagctgcgc 1141 ctcagatggg gcgctcatac ccaggaggct gcagccatag gcgcggggtg tggcttcccc 1201 aaggatgtgc ctttcatgca aatctgaagt gctcattata ctgggagagc tggggattct 1261 aactccctaa tgggcaatcc ctgtgtgtgc tctttgcttc ctctgaagta gcctcatccc 1321 taaattttta ccttcgagga atgtgactcg ctggcccctg gaggcgctct gacccagtgg 1381 tctctgtcct tcatattgtt cactgcactg tatgcgaagc acttacatgt atagatactg 1441 caaaccaagg acagaatccc caattgccat tgttccctta atttgtcgct gaatctgggc 1501 tgagtcccag tcttgactct ggacctaagc cacaagttgg gcaaacatgt ccaacctagg 1561 caatactggc tttgctagat gtgaataaaa tatgctttgt tttgt //