LOCUS       AK057792                1161 bp    mRNA    linear   HUM 13-SEP-2006
DEFINITION  Homo sapiens cDNA FLJ25063 fis, clone CBL04869, highly similar to
            COMPLEMENT C1Q SUBCOMPONENT, C CHAIN PRECURSOR.
ACCESSION   AK057792
VERSION     AK057792.1
KEYWORDS    FLI_CDNA; oligo capping; fis (full insert sequence).
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1161)
  AUTHORS   Sugano,S. and Suzuki,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-OCT-2001) to the DDBJ/EMBL/GenBank databases.
            Contact:Sumio Sugano
            Institute of Medical Science, University of Tokyo, Laboratory of
            Genome Structure, Human Genome Center; Shirokane-dai, 4-6-1,
            Minato-ku, Tokyo 108-8639, Japan
REFERENCE   2
  AUTHORS   Nishi,T., Nakagawa,S., Senoh,A., Mizuguchi,H., Inagaki,H.,
            Suzuki,Y., Hata,H., Nakagawa,K., Mizuno,S., Morinaga,M.,
            Kawamura,M., Sugiyama,T., Irie,R., Otsuki,T., Sato,H.,
            Nishikawa,T., Sugiyama,A., Kawakami,B., Nagai,K., Isogai,T. and
            Sugano,S.
  TITLE     NEDO human cDNA sequencing project
  JOURNAL   Unpublished (2001)
COMMENT     NEDO human cDNA sequencing project supported by Ministry of
            Economy, Trade and Industry of Japan; cDNA full insert sequencing:
            Research Association for Biotechnology (RAB); cDNA library
            construction and 5'-end one pass sequencing: Institute of Medical
            Science, University of Tokyo, Laboratory of Genome Structure,
            Human Genome Center; 3'-end one pass sequencing: RAB; clone
            selection for full insert sequencing: RAB and Helix Research
            Institute.
FEATURES             Location/Qualifiers
     source          1..1161
                     /clone="CBL04869"
                     /clone_lib="CBL"
                     /db_xref="H-InvDB:HIT000014399"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="cerebellum"
     CDS             119..856
                     /codon_start=1
                     /protein_id="BAB71575.1"
                     /translation="MDVGPSSLPHLGLRLLLLLLLLPLRGQANTGCYGIPGMPGLPGA
                     PGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPM
                     GIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTC
                     KVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGGEVW
                     LAVNDYYDMVGIQGSDSVFSGFLLFPD"
BASE COUNT          229 a          380 c          324 g          228 t
ORIGIN      
        1 agacaccgtg tcctcttgcc tgggagaggg gaagcagatc tgaggacatc tctgtgccag
       61 gccagaaacc gcccacctgc aggtgaggcc cggacccctg cccagttcct tctccgggat
      121 ggacgtgggg cccagctccc tgccccacct tgggctgagg ctgctgctgc tcctgctgct
      181 gctgcccctc aggggccaag ccaacacagg ctgctacggg atcccaggga tgcccggcct
      241 gcctggggca ccagggaagg atgggtacga cggactgccg gggcccaagg gggagccagg
      301 aatcccagcc attcccggga tccgaggacc caaagggcag aagggagaac ccggcttacc
      361 cggccatcct gggaaaaatg gccccatggg accccctggg atgccagggg tgcccggccc
      421 catgggcatc cctggagagc caggtgagga gggcagatac aagcagaaat tccagtcagt
      481 gttcacggtc actcggcaga cccaccagcc ccctgcaccc aacagcctga tcagattcaa
      541 cgcggtcctc accaacccgc agggagatta tgacacgagc actggcaagt tcacctgcaa
      601 agtccccggc ctctactact ttgtctacca cgcgtcgcat acagccaacc tgtgcgtgct
      661 gctgtaccgc agcggcgtca aagtggtcac cttctgtggc cacacgtcca aaaccaatca
      721 ggtcaactcg ggcggtgtgc tgctgaggtt gcaggtgggc ggggaggtgt ggctggctgt
      781 caatgactac tacgacatgg tgggcatcca gggctctgac agcgtcttct ccggcttcct
      841 gctcttcccc gactagggcg ggcagatgcg ctcgagaccc acgggccttc cacctccctc
      901 agcttcctgc atggacccac cttactggcc agtctgcatc cttgcctaga ccattctccc
      961 ctccagggag cccaccctga cccaccccca ctgcaccccc tccccatggg ttctctcctt
     1021 cctctgaact tctttaggag tcactgcttg tgtggttcct gggacactta accaatgcct
     1081 tctggtactg ccattctttt ttttttttca agtattggaa ggggtgggga gatatataaa
     1141 taaatcatga aatcaataca t
//