LOCUS AK057792 1161 bp mRNA linear HUM 13-SEP-2006 DEFINITION Homo sapiens cDNA FLJ25063 fis, clone CBL04869, highly similar to COMPLEMENT C1Q SUBCOMPONENT, C CHAIN PRECURSOR. ACCESSION AK057792 VERSION AK057792.1 KEYWORDS FLI_CDNA; oligo capping; fis (full insert sequence). SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1161) AUTHORS Sugano,S. and Suzuki,Y. TITLE Direct Submission JOURNAL Submitted (24-OCT-2001) to the DDBJ/EMBL/GenBank databases. Contact:Sumio Sugano Institute of Medical Science, University of Tokyo, Laboratory of Genome Structure, Human Genome Center; Shirokane-dai, 4-6-1, Minato-ku, Tokyo 108-8639, Japan REFERENCE 2 AUTHORS Nishi,T., Nakagawa,S., Senoh,A., Mizuguchi,H., Inagaki,H., Suzuki,Y., Hata,H., Nakagawa,K., Mizuno,S., Morinaga,M., Kawamura,M., Sugiyama,T., Irie,R., Otsuki,T., Sato,H., Nishikawa,T., Sugiyama,A., Kawakami,B., Nagai,K., Isogai,T. and Sugano,S. TITLE NEDO human cDNA sequencing project JOURNAL Unpublished (2001) COMMENT NEDO human cDNA sequencing project supported by Ministry of Economy, Trade and Industry of Japan; cDNA full insert sequencing: Research Association for Biotechnology (RAB); cDNA library construction and 5'-end one pass sequencing: Institute of Medical Science, University of Tokyo, Laboratory of Genome Structure, Human Genome Center; 3'-end one pass sequencing: RAB; clone selection for full insert sequencing: RAB and Helix Research Institute. FEATURES Location/Qualifiers source 1..1161 /clone="CBL04869" /clone_lib="CBL" /db_xref="H-InvDB:HIT000014399" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /organism="Homo sapiens" /tissue_type="cerebellum" CDS 119..856 /codon_start=1 /protein_id="BAB71575.1" /translation="MDVGPSSLPHLGLRLLLLLLLLPLRGQANTGCYGIPGMPGLPGA PGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPM GIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTC KVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGGEVW LAVNDYYDMVGIQGSDSVFSGFLLFPD" BASE COUNT 229 a 380 c 324 g 228 t ORIGIN 1 agacaccgtg tcctcttgcc tgggagaggg gaagcagatc tgaggacatc tctgtgccag 61 gccagaaacc gcccacctgc aggtgaggcc cggacccctg cccagttcct tctccgggat 121 ggacgtgggg cccagctccc tgccccacct tgggctgagg ctgctgctgc tcctgctgct 181 gctgcccctc aggggccaag ccaacacagg ctgctacggg atcccaggga tgcccggcct 241 gcctggggca ccagggaagg atgggtacga cggactgccg gggcccaagg gggagccagg 301 aatcccagcc attcccggga tccgaggacc caaagggcag aagggagaac ccggcttacc 361 cggccatcct gggaaaaatg gccccatggg accccctggg atgccagggg tgcccggccc 421 catgggcatc cctggagagc caggtgagga gggcagatac aagcagaaat tccagtcagt 481 gttcacggtc actcggcaga cccaccagcc ccctgcaccc aacagcctga tcagattcaa 541 cgcggtcctc accaacccgc agggagatta tgacacgagc actggcaagt tcacctgcaa 601 agtccccggc ctctactact ttgtctacca cgcgtcgcat acagccaacc tgtgcgtgct 661 gctgtaccgc agcggcgtca aagtggtcac cttctgtggc cacacgtcca aaaccaatca 721 ggtcaactcg ggcggtgtgc tgctgaggtt gcaggtgggc ggggaggtgt ggctggctgt 781 caatgactac tacgacatgg tgggcatcca gggctctgac agcgtcttct ccggcttcct 841 gctcttcccc gactagggcg ggcagatgcg ctcgagaccc acgggccttc cacctccctc 901 agcttcctgc atggacccac cttactggcc agtctgcatc cttgcctaga ccattctccc 961 ctccagggag cccaccctga cccaccccca ctgcaccccc tccccatggg ttctctcctt 1021 cctctgaact tctttaggag tcactgcttg tgtggttcct gggacactta accaatgcct 1081 tctggtactg ccattctttt ttttttttca agtattggaa ggggtgggga gatatataaa 1141 taaatcatga aatcaataca t //