LOCUS AK057774 1328 bp mRNA linear HUM 13-SEP-2006
DEFINITION Homo sapiens cDNA FLJ25045 fis, clone CBL03591.
ACCESSION AK057774
VERSION AK057774.1
KEYWORDS FLI_CDNA; oligo capping; fis (full insert sequence).
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1328)
AUTHORS Sugano,S. and Suzuki,Y.
TITLE Direct Submission
JOURNAL Submitted (24-OCT-2001) to the DDBJ/EMBL/GenBank databases.
Contact:Sumio Sugano
Institute of Medical Science, University of Tokyo, Laboratory of
Genome Structure, Human Genome Center; Shirokane-dai, 4-6-1,
Minato-ku, Tokyo 108-8639, Japan
REFERENCE 2
AUTHORS Nishi,T., Nakagawa,S., Senoh,A., Mizuguchi,H., Inagaki,H.,
Suzuki,Y., Hata,H., Nakagawa,K., Mizuno,S., Morinaga,M.,
Kawamura,M., Sugiyama,T., Irie,R., Otsuki,T., Sato,H.,
Nishikawa,T., Sugiyama,A., Kawakami,B., Nagai,K., Isogai,T. and
Sugano,S.
TITLE NEDO human cDNA sequencing project
JOURNAL Unpublished (2001)
COMMENT NEDO human cDNA sequencing project supported by Ministry of
Economy, Trade and Industry of Japan; cDNA full insert sequencing:
Research Association for Biotechnology (RAB); cDNA library
construction and 5'-end one pass sequencing: Institute of Medical
Science, University of Tokyo, Laboratory of Genome Structure,
Human Genome Center; 3'-end one pass sequencing: RAB; clone
selection for full insert sequencing: RAB and Helix Research
Institute.
FEATURES Location/Qualifiers
source 1..1328
/clone="CBL03591"
/clone_lib="CBL"
/db_xref="H-InvDB:HIT000014381"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/organism="Homo sapiens"
/tissue_type="cerebellum"
CDS 60..1004
/codon_start=1
/protein_id="BAB71566.1"
/translation="MERLNARHGGRFALLRIVNVEKRRDSARGSRFLLELELQERGGG
RLRLSEYVFLRLPGARVGDADGESPEPAPAASVRPDGRPELCRPLRLAWRQDVMVHFI
VPVKNQARWVAQFLADMAALHARTGDSRFSVVLVDFESEDMDVERALRAARLPRYQYL
RRTGNFERSAGLQAGVDAVEDASSIVFLCDLHIHFPPNILDGIRKHCVEGRLAFAPMV
MRLSCGSSPRDPHGYWEVNGFGLFGIYKSDFDRVGGMNTEEFRDQWGGEDWELLDRVL
QAGLEVERLRLRNFYHHYHSKRGMWSVRSRKGSRTGAS"
BASE COUNT 213 a 401 c 467 g 247 t
ORIGIN
1 acgtttcggg gaacctgcag ctgccggagg cggaggccgt ggacgtgacc gctcagtaca
61 tggagcggct gaacgcgcgc cacggcgggc gcttcgcgct tctgcgcatc gtgaacgtgg
121 agaagcgccg ggactcggcg cgagggagtc gcttcctgct ggagctggag ctgcaggagc
181 gcgggggcgg ccgcctgcga ctgtccgagt acgtcttcct gcggctgccg ggagcccgcg
241 taggggatgc agacggagaa agtcccgagc ccgctcccgc cgcctccgtg cgccccgacg
301 gccgccccga gctctgccgg ccactgcgcc tggcctggcg ccaggacgtg atggttcact
361 tcatcgtgcc agtgaaaaac caggcacggt gggtggcaca gttcctggcg gacatggctg
421 cgctgcacgc gcgcaccggg gactcgcgtt tcagcgtcgt cctggtggat ttcgagagcg
481 aggatatgga cgtggagcgg gccctgcgcg ccgcgcgcct gccccggtac cagtacctga
541 gacgaaccgg gaacttcgag cgctccgccg ggctgcaggc gggagtggac gcggtagagg
601 acgccagcag catcgtgttc ctctgcgacc tgcacatcca cttcccaccc aacatcctgg
661 acggcatccg caagcactgc gtggagggca ggctggcctt cgcgcccatg gtcatgcgcc
721 tgagctgcgg gagctcgccc cgggaccccc acggttactg ggaggtgaac ggctttggcc
781 tttttgggat ctacaagtcg gactttgacc gggttggagg aatgaacacg gaggagttcc
841 gagaccagtg ggggggtgaa gactgggagc tcctggacag ggtcctgcag gcagggctgg
901 aggtggagcg gctccgactg cggaatttct atcaccacta ccactccaag aggggcatgt
961 ggagcgtccg cagcaggaag ggctctcgca cgggggcgtc ttgaggacgg gcagcccctc
1021 ccagccccgg tgggagtccc gaggcagctg ctgggggctg ggctttgagc tcggtcccga
1081 gagacccggc agggctggtc agaggggcac agccaccgcc tgtgcctgcc cctctctggc
1141 ccactgggcg tcgtgcccct ccccggagag gcagccttca cggcgggtca gggcctggcc
1201 ttggtcccca ctctgcgatg atttctgtga aattttgctg tagcgatgac attgttttca
1261 gaatttccaa gagttctgtc tgttctgttt tttattcaga atgaaatgaa atattttttt
1321 tagttttg
//