LOCUS       AK026874                 519 bp    mRNA    linear   HUM 12-SEP-2006
DEFINITION  Homo sapiens cDNA: FLJ23221 fis, clone ADSU01965.
ACCESSION   AK026874
VERSION     AK026874.1
KEYWORDS    FLI_CDNA; oligo capping; fis (full insert sequence).
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 519)
  AUTHORS   Sugano,S., Suzuki,Y., Ota,T., Obayashi,M., Nishi,T., Isogai,T.,
            Shibahara,T., Tanaka,T. and Nakamura,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-AUG-2000) to the DDBJ/EMBL/GenBank databases.
            Contact:Sumio Sugano
            Institute of Medical Science, University of Tokyo, Laboratory of
            Genome Structure Analysis, Human Genome Center; Shirokane-dai,
            4-6-1, Minato-ku, Tokyo 108-8639, Japan
REFERENCE   2
  AUTHORS   Kawakami,T., Noguchi,S., Itoh,T., Shigeta,K., Senba,T.,
            Matsumura,K., Nakajima,Y., Mizuno,T., Morinaga,M., Tanigami,A.,
            Fujiwara,T., Ono,T., Yamada,K., Fujii,Y., Ozaki,K., Hirao,M.,
            Ohmori,Y., Ota,T., Suzuki,Y., Obayashi,M., Nishi,T., Shibahara,T.,
            Tanaka,T., Nakamura,Y., Isogai,T. and Sugano,S.
  TITLE     NEDO human cDNA sequencing project
  JOURNAL   Unpublished (2000)
COMMENT     NEDO human cDNA sequencing project supported by Ministry of
            International Trade and Industry of Japan; cDNA full insert
            sequencing: Research Association for Biotechnology; cDNA library
            construction, 5'- & 3'-end one pass sequencing: Departent of
            Virology and Human Genome Center, Institute of Medical Science,
            University of Tokyo (partly supported by Science and Technology
            Agency).
FEATURES             Location/Qualifiers
     source          1..519
                     /clone="ADSU01965"
                     /clone_lib="ad"
                     /db_xref="H-InvDB:HIT000010148"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="adipose tissue"
     CDS             24..419
                     /codon_start=1
                     /protein_id="BAB15579.1"
                     /translation="MDVLFVAIFAVPLILGQEYEDEERLGEDEYYQVVYYYTVTPSYD
                     DFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSP
                     DLNDAVSSLRSPIPLLLSRAFVQVGMYFM"
BASE COUNT          169 a           95 c          125 g          130 t
ORIGIN      
        1 acagcaatag tgcagaatcc agaatggatg tcctctttgt agccatcttt gctgtgccac
       61 ttatcctggg acaagaatat gaggatgaag aaagactggg agaggatgaa tattatcagg
      121 tggtctatta ttatacagtc acccccagtt atgatgactt tagtgcagat ttcaccattg
      181 attactccat atttgagtca gaggacaggc tgaacaggtt ggataaggac ataacagaag
      241 caatagagac taccattagt cttgaaacag cacgtgcaga ccatccgaag cctgtaactg
      301 tgaaaccagt aacaacggaa cctagtccag atctgaacga tgccgtgtcc agtttgcgaa
      361 gtcctattcc cctcctcctg tcgcgtgcct ttgttcaggt ggggatgtat ttcatgtaga
      421 aggtggaaga aggctgctat gactctttgg atgggagtct ggcaagagga aattggaaga
      481 taaaataaat aataagtgaa ataaagaaaa aaaaaaaaa
//