LOCUS AK026874 519 bp mRNA linear HUM 12-SEP-2006 DEFINITION Homo sapiens cDNA: FLJ23221 fis, clone ADSU01965. ACCESSION AK026874 VERSION AK026874.1 KEYWORDS FLI_CDNA; oligo capping; fis (full insert sequence). SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 519) AUTHORS Sugano,S., Suzuki,Y., Ota,T., Obayashi,M., Nishi,T., Isogai,T., Shibahara,T., Tanaka,T. and Nakamura,Y. TITLE Direct Submission JOURNAL Submitted (29-AUG-2000) to the DDBJ/EMBL/GenBank databases. Contact:Sumio Sugano Institute of Medical Science, University of Tokyo, Laboratory of Genome Structure Analysis, Human Genome Center; Shirokane-dai, 4-6-1, Minato-ku, Tokyo 108-8639, Japan REFERENCE 2 AUTHORS Kawakami,T., Noguchi,S., Itoh,T., Shigeta,K., Senba,T., Matsumura,K., Nakajima,Y., Mizuno,T., Morinaga,M., Tanigami,A., Fujiwara,T., Ono,T., Yamada,K., Fujii,Y., Ozaki,K., Hirao,M., Ohmori,Y., Ota,T., Suzuki,Y., Obayashi,M., Nishi,T., Shibahara,T., Tanaka,T., Nakamura,Y., Isogai,T. and Sugano,S. TITLE NEDO human cDNA sequencing project JOURNAL Unpublished (2000) COMMENT NEDO human cDNA sequencing project supported by Ministry of International Trade and Industry of Japan; cDNA full insert sequencing: Research Association for Biotechnology; cDNA library construction, 5'- & 3'-end one pass sequencing: Departent of Virology and Human Genome Center, Institute of Medical Science, University of Tokyo (partly supported by Science and Technology Agency). FEATURES Location/Qualifiers source 1..519 /clone="ADSU01965" /clone_lib="ad" /db_xref="H-InvDB:HIT000010148" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector pME18SFL3" /organism="Homo sapiens" /tissue_type="adipose tissue" CDS 24..419 /codon_start=1 /protein_id="BAB15579.1" /translation="MDVLFVAIFAVPLILGQEYEDEERLGEDEYYQVVYYYTVTPSYD DFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSP DLNDAVSSLRSPIPLLLSRAFVQVGMYFM" BASE COUNT 169 a 95 c 125 g 130 t ORIGIN 1 acagcaatag tgcagaatcc agaatggatg tcctctttgt agccatcttt gctgtgccac 61 ttatcctggg acaagaatat gaggatgaag aaagactggg agaggatgaa tattatcagg 121 tggtctatta ttatacagtc acccccagtt atgatgactt tagtgcagat ttcaccattg 181 attactccat atttgagtca gaggacaggc tgaacaggtt ggataaggac ataacagaag 241 caatagagac taccattagt cttgaaacag cacgtgcaga ccatccgaag cctgtaactg 301 tgaaaccagt aacaacggaa cctagtccag atctgaacga tgccgtgtcc agtttgcgaa 361 gtcctattcc cctcctcctg tcgcgtgcct ttgttcaggt ggggatgtat ttcatgtaga 421 aggtggaaga aggctgctat gactctttgg atgggagtct ggcaagagga aattggaaga 481 taaaataaat aataagtgaa ataaagaaaa aaaaaaaaa //