LOCUS       AK024803                 658 bp    mRNA    linear   HUM 12-SEP-2006
DEFINITION  Homo sapiens cDNA: FLJ21150 fis, clone CAS09561.
ACCESSION   AK024803
VERSION     AK024803.1
KEYWORDS    FLI_CDNA; oligo capping; fis (full insert sequence).
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 658)
  AUTHORS   Sugano,S., Suzuki,Y., Ota,T., Obayashi,M., Nishi,T., Isogai,T.,
            Shibahara,T., Tanaka,T. and Nakamura,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-AUG-2000) to the DDBJ/EMBL/GenBank databases.
            Contact:Sumio Sugano
            Institute of Medical Science, University of Tokyo, Laboratory of
            Genome Structure Analysis, Human Genome Center; Shirokane-dai,
            4-6-1, Minato-ku, Tokyo 108-8639, Japan
REFERENCE   2
  AUTHORS   Watanabe,K., Kumagai,A., Itakura,S., Yamazaki,M., Tashiro,H.,
            Ota,T., Suzuki,Y., Obayashi,M., Nishi,T., Shibahara,T., Tanaka,T.,
            Nakamura,Y., Isogai,T. and Sugano,S.
  TITLE     NEDO human cDNA sequencing project
  JOURNAL   Unpublished (2000)
COMMENT     NEDO human cDNA sequencing project supported by Ministry of
            International Trade and Industry of Japan; cDNA full insert
            sequencing: Research Association for Biotechnology; cDNA library
            construction, 5'- & 3'-end one pass sequencing: Departent of
            Virology and Human Genome Center, Institute of Medical Science,
            University of Tokyo (partly supported by Science and Technology
            Agency).
FEATURES             Location/Qualifiers
     source          1..658
                     /cell_type="primary smooth muscle cells of human coronary
                     artery"
                     /clone="CAS09561"
                     /clone_lib="CAS"
                     /db_xref="H-InvDB:HIT000008077"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector pME18SFL3"
                     /organism="Homo sapiens"
     CDS             15..>658
                     /codon_start=1
                     /protein_id="BAB15012.1"
                     /translation="MAPNLKGRPRKKKPCPQRRDSFSGVKDSNNNSDGKAVAKVKCEA
                     RSALTKPKNNHNCKKVSNEEKPKVAIGEECRADEQAFLVALYKYMKERKTPIERIPYL
                     GFKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLIL
                     PYERFIKGEEDKPLPPIKPRKQENSSQENENKTKVSGTKRIKHEIPKSKKKKKK"
BASE COUNT          262 a          130 c          138 g          128 t
ORIGIN      
        1 gtttgtcgac tggaatggcg ccaaatctta aaggcagacc acgcaaaaag aaaccatgcc
       61 cacaaagaag agattcattc agtggtgtta aggattccaa caacaattcc gatggcaaag
      121 ccgttgccaa ggtgaaatgt gaggccaggt cagccttgac caagccgaag aataaccata
      181 actgtaaaaa agtctcaaat gaagaaaaac caaaggttgc cattggtgaa gagtgcaggg
      241 cagatgaaca agccttcttg gtggcacttt ataaatacat gaaagaaagg aaaacgccga
      301 tagaacgaat accctattta ggttttaaac agattaacct ttggactatg tttcaagctg
      361 ctcaaaaact gggaggatat gaaacaataa cagcccgccg tcagtggaaa catatttatg
      421 atgaattagg cggtaatcct gggagcacca gcgctgccac ttgtacccgc agacattatg
      481 aaagattaat cctaccatat gaaagattta ttaaaggaga agaagataag cccctgcctc
      541 caatcaaacc tcggaaacag gagaacagtt cacaggaaaa tgagaacaaa acaaaagtat
      601 ctggaaccaa acgcatcaaa catgaaatac ctaaaagcaa gaaaaaaaaa aaaaaaaa
//