LOCUS AK024803 658 bp mRNA linear HUM 12-SEP-2006 DEFINITION Homo sapiens cDNA: FLJ21150 fis, clone CAS09561. ACCESSION AK024803 VERSION AK024803.1 KEYWORDS FLI_CDNA; oligo capping; fis (full insert sequence). SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 658) AUTHORS Sugano,S., Suzuki,Y., Ota,T., Obayashi,M., Nishi,T., Isogai,T., Shibahara,T., Tanaka,T. and Nakamura,Y. TITLE Direct Submission JOURNAL Submitted (29-AUG-2000) to the DDBJ/EMBL/GenBank databases. Contact:Sumio Sugano Institute of Medical Science, University of Tokyo, Laboratory of Genome Structure Analysis, Human Genome Center; Shirokane-dai, 4-6-1, Minato-ku, Tokyo 108-8639, Japan REFERENCE 2 AUTHORS Watanabe,K., Kumagai,A., Itakura,S., Yamazaki,M., Tashiro,H., Ota,T., Suzuki,Y., Obayashi,M., Nishi,T., Shibahara,T., Tanaka,T., Nakamura,Y., Isogai,T. and Sugano,S. TITLE NEDO human cDNA sequencing project JOURNAL Unpublished (2000) COMMENT NEDO human cDNA sequencing project supported by Ministry of International Trade and Industry of Japan; cDNA full insert sequencing: Research Association for Biotechnology; cDNA library construction, 5'- & 3'-end one pass sequencing: Departent of Virology and Human Genome Center, Institute of Medical Science, University of Tokyo (partly supported by Science and Technology Agency). FEATURES Location/Qualifiers source 1..658 /cell_type="primary smooth muscle cells of human coronary artery" /clone="CAS09561" /clone_lib="CAS" /db_xref="H-InvDB:HIT000008077" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector pME18SFL3" /organism="Homo sapiens" CDS 15..>658 /codon_start=1 /protein_id="BAB15012.1" /translation="MAPNLKGRPRKKKPCPQRRDSFSGVKDSNNNSDGKAVAKVKCEA RSALTKPKNNHNCKKVSNEEKPKVAIGEECRADEQAFLVALYKYMKERKTPIERIPYL GFKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLIL PYERFIKGEEDKPLPPIKPRKQENSSQENENKTKVSGTKRIKHEIPKSKKKKKK" BASE COUNT 262 a 130 c 138 g 128 t ORIGIN 1 gtttgtcgac tggaatggcg ccaaatctta aaggcagacc acgcaaaaag aaaccatgcc 61 cacaaagaag agattcattc agtggtgtta aggattccaa caacaattcc gatggcaaag 121 ccgttgccaa ggtgaaatgt gaggccaggt cagccttgac caagccgaag aataaccata 181 actgtaaaaa agtctcaaat gaagaaaaac caaaggttgc cattggtgaa gagtgcaggg 241 cagatgaaca agccttcttg gtggcacttt ataaatacat gaaagaaagg aaaacgccga 301 tagaacgaat accctattta ggttttaaac agattaacct ttggactatg tttcaagctg 361 ctcaaaaact gggaggatat gaaacaataa cagcccgccg tcagtggaaa catatttatg 421 atgaattagg cggtaatcct gggagcacca gcgctgccac ttgtacccgc agacattatg 481 aaagattaat cctaccatat gaaagattta ttaaaggaga agaagataag cccctgcctc 541 caatcaaacc tcggaaacag gagaacagtt cacaggaaaa tgagaacaaa acaaaagtat 601 ctggaaccaa acgcatcaaa catgaaatac ctaaaagcaa gaaaaaaaaa aaaaaaaa //