LOCUS       AK000598                 865 bp    mRNA    linear   HUM 12-SEP-2006
DEFINITION  Homo sapiens cDNA FLJ20591 fis, clone KAT09018.
ACCESSION   AK000598
VERSION     AK000598.1
KEYWORDS    FLI_CDNA; oligo capping; fis (full insert sequence).
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 865)
  AUTHORS   Sugano,S., Suzuki,Y., Ota,T., Obayashi,M., Nishi,T., Isogai,T.,
            Shibahara,T., Tanaka,T. and Nakamura,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-FEB-2000) to the DDBJ/EMBL/GenBank databases.
            Contact:Sumio Sugano
            Institute of Medical Science, University of Tokyo, Deptment of
            Virology; Shirokane-dai, 4-6-1, Minato-ku, Tokyo 108-8639, Japan
REFERENCE   2
  AUTHORS   Watanabe,K., Kumagai,A., Itakura,S., Yamazaki,M., Tashiro,H.,
            Ota,T., Suzuki,Y., Obayashi,M., Nishi,T., Shibahara,T., Tanaka,T.,
            Nakamura,Y., Isogai,T. and Sugano,S.
  TITLE     NEDO human cDNA sequencing project
  JOURNAL   Unpublished (2000)
COMMENT     NEDO human cDNA sequencing project supported by Ministry of
            International Trade and Industry of Japan; cDNA full insert
            sequencing: Research Association for Biotechnology; cDNA library
            construction, 5'- & 3'-end one pass sequencing: Departent of
            Virology and Human Genome Center, Institute of Medical Science,
            University of Tokyo (partly supported by Science and Technology
            Agency).
FEATURES             Location/Qualifiers
     source          1..865
                     /cell_line="KATO III"
                     /cell_type="signet-ring cell carcinoma"
                     /clone="KAT09018"
                     /clone_lib="KAT"
                     /db_xref="H-InvDB:HIT000003073"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector pME18SFL3"
                     /organism="Homo sapiens"
     CDS             28..765
                     /codon_start=1
                     /protein_id="BAA91279.1"
                     /translation="MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQG
                     NTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQ
                     LRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCAC
                     SAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHLERVLEAAA
                     QAARDVHTLLDRVVRQHVREASILLGD"
BASE COUNT          203 a          247 c          274 g          141 t
ORIGIN      
        1 agagagcgga cctggcggcc gggcagcatg gcggggctgg agctcttgtc ggaccagggc
       61 taccgggtgg acgggcggcg cgccggggag ctgcgcaaga tccaggcgcg gatgggcgtg
      121 ttcgcgcagg ctgacggctc ggcctacatt gagcagggca acaccaaggc actggctgtg
      181 gtctacggcc cgcacgagat ccggggctcc cgggctcgag ccctgccgga cagggcccta
      241 gtgaactgtc aatatagttc agcgaccttc agcacaggtg agcgcaagcg acggccacat
      301 ggggaccgta agtcctgtga gatgggcctg cagctccgcc agactttcga agcagccatc
      361 ctcacacagc tgcacccacg ctcccagatt gatatctatg tgcaggtgct acaggcagat
      421 ggtgggacct atgcagcttg tgtgaatgca gccacgctgg cagtgctgga tgccgggata
      481 cccatgagag actttgtgtg tgcgtgctca gctggcttcg tggacggcac agccctggcg
      541 gacctcagcc atgtggagga agcagctggt ggcccccagc tggccctggc cctgctgcca
      601 gcctcaggac agattgcgct gcttgagatg gatgcccggc tgcacgagga ccacctggag
      661 cgggtgttgg aggctgctgc ccaggctgcc cgagatgtgc acaccctctt agatcgagtg
      721 gtccggcagc atgtgcgtga ggcctctatc ttgctggggg actgaccacc cagccaccca
      781 tgtccagaat aaaaccctcc tctgcccaca caaaaaaaaa aaaaaaaaaa aaaaaaaaaa
      841 aaaaaaaaaa aaaaaaaaaa aaaaa
//