LOCUS AK000598 865 bp mRNA linear HUM 12-SEP-2006 DEFINITION Homo sapiens cDNA FLJ20591 fis, clone KAT09018. ACCESSION AK000598 VERSION AK000598.1 KEYWORDS FLI_CDNA; oligo capping; fis (full insert sequence). SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 865) AUTHORS Sugano,S., Suzuki,Y., Ota,T., Obayashi,M., Nishi,T., Isogai,T., Shibahara,T., Tanaka,T. and Nakamura,Y. TITLE Direct Submission JOURNAL Submitted (15-FEB-2000) to the DDBJ/EMBL/GenBank databases. Contact:Sumio Sugano Institute of Medical Science, University of Tokyo, Deptment of Virology; Shirokane-dai, 4-6-1, Minato-ku, Tokyo 108-8639, Japan REFERENCE 2 AUTHORS Watanabe,K., Kumagai,A., Itakura,S., Yamazaki,M., Tashiro,H., Ota,T., Suzuki,Y., Obayashi,M., Nishi,T., Shibahara,T., Tanaka,T., Nakamura,Y., Isogai,T. and Sugano,S. TITLE NEDO human cDNA sequencing project JOURNAL Unpublished (2000) COMMENT NEDO human cDNA sequencing project supported by Ministry of International Trade and Industry of Japan; cDNA full insert sequencing: Research Association for Biotechnology; cDNA library construction, 5'- & 3'-end one pass sequencing: Departent of Virology and Human Genome Center, Institute of Medical Science, University of Tokyo (partly supported by Science and Technology Agency). FEATURES Location/Qualifiers source 1..865 /cell_line="KATO III" /cell_type="signet-ring cell carcinoma" /clone="KAT09018" /clone_lib="KAT" /db_xref="H-InvDB:HIT000003073" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector pME18SFL3" /organism="Homo sapiens" CDS 28..765 /codon_start=1 /protein_id="BAA91279.1" /translation="MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQG NTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQ LRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCAC SAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHLERVLEAAA QAARDVHTLLDRVVRQHVREASILLGD" BASE COUNT 203 a 247 c 274 g 141 t ORIGIN 1 agagagcgga cctggcggcc gggcagcatg gcggggctgg agctcttgtc ggaccagggc 61 taccgggtgg acgggcggcg cgccggggag ctgcgcaaga tccaggcgcg gatgggcgtg 121 ttcgcgcagg ctgacggctc ggcctacatt gagcagggca acaccaaggc actggctgtg 181 gtctacggcc cgcacgagat ccggggctcc cgggctcgag ccctgccgga cagggcccta 241 gtgaactgtc aatatagttc agcgaccttc agcacaggtg agcgcaagcg acggccacat 301 ggggaccgta agtcctgtga gatgggcctg cagctccgcc agactttcga agcagccatc 361 ctcacacagc tgcacccacg ctcccagatt gatatctatg tgcaggtgct acaggcagat 421 ggtgggacct atgcagcttg tgtgaatgca gccacgctgg cagtgctgga tgccgggata 481 cccatgagag actttgtgtg tgcgtgctca gctggcttcg tggacggcac agccctggcg 541 gacctcagcc atgtggagga agcagctggt ggcccccagc tggccctggc cctgctgcca 601 gcctcaggac agattgcgct gcttgagatg gatgcccggc tgcacgagga ccacctggag 661 cgggtgttgg aggctgctgc ccaggctgcc cgagatgtgc acaccctctt agatcgagtg 721 gtccggcagc atgtgcgtga ggcctctatc ttgctggggg actgaccacc cagccaccca 781 tgtccagaat aaaaccctcc tctgcccaca caaaaaaaaa aaaaaaaaaa aaaaaaaaaa 841 aaaaaaaaaa aaaaaaaaaa aaaaa //