LOCUS       AK000502                 831 bp    mRNA    linear   HUM 12-SEP-2006
DEFINITION  Homo sapiens cDNA FLJ20495 fis, clone KAT08572.
ACCESSION   AK000502
VERSION     AK000502.1
KEYWORDS    FLI_CDNA; oligo capping; fis (full insert sequence).
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 831)
  AUTHORS   Sugano,S., Suzuki,Y., Ota,T., Obayashi,M., Nishi,T., Isogai,T.,
            Shibahara,T., Tanaka,T. and Nakamura,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-FEB-2000) to the DDBJ/EMBL/GenBank databases.
            Contact:Sumio Sugano
            Institute of Medical Science, University of Tokyo, Deptment of
            Virology; Shirokane-dai, 4-6-1, Minato-ku, Tokyo 108-8639, Japan
REFERENCE   2
  AUTHORS   Watanabe,K., Kumagai,A., Itakura,S., Yamazaki,M., Tashiro,H.,
            Ota,T., Suzuki,Y., Obayashi,M., Nishi,T., Shibahara,T., Tanaka,T.,
            Nakamura,Y., Isogai,T. and Sugano,S.
  TITLE     NEDO human cDNA sequencing project
  JOURNAL   Unpublished (2000)
COMMENT     NEDO human cDNA sequencing project supported by Ministry of
            International Trade and Industry of Japan; cDNA full insert
            sequencing: Research Association for Biotechnology; cDNA library
            construction, 5'- & 3'-end one pass sequencing: Departent of
            Virology and Human Genome Center, Institute of Medical Science,
            University of Tokyo (partly supported by Science and Technology
            Agency).
FEATURES             Location/Qualifiers
     source          1..831
                     /cell_line="KATO III"
                     /cell_type="signet-ring cell carcinoma"
                     /clone="KAT08572"
                     /clone_lib="KAT"
                     /db_xref="H-InvDB:HIT000002977"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector pME18SFL3"
                     /organism="Homo sapiens"
     CDS             54..599
                     /codon_start=1
                     /protein_id="BAA91209.1"
                     /translation="MLLVDADQPEPMRSGARELALFLTPEPGAEAKEVEETIEGMLLR
                     LEEFCSLADLIRSDTSQILEENIPVLKAKLTEMRGIYAKVDRLEAFVKMVGHHVAFLE
                     ADVLQAERDHGAFPQALRRWLGSAGLPSFRNVECSGTIPARCNLRLPGSSDSPASASQ
                     VAGITEVTCTGARDVRAAHTV"
BASE COUNT          201 a          237 c          227 g          166 t
ORIGIN      
        1 gcaaccacgg gctcccaggc agcctccgcc agccggaccc cgtcgccctc ctgatgctgc
       61 tcgtggacgc tgatcagccg gagcccatgc gcagcggggc gcgcgagctc gcgctcttcc
      121 tgacccccga gcctggggcc gaggcgaagg aggtggagga gaccatcgag ggcatgctcc
      181 tcaggctgga agagttttgc agcctggctg acctgatcag gagtgatact tcacagatcc
      241 tggaggaaaa catcccagtc cttaaggcca aactgacaga aatgcgtggc atctatgcca
      301 aagtggaccg gctagaggcc ttcgtcaaga tggttggaca ccacgtcgcc ttcctggaag
      361 cagacgtgct tcaggctgag cgggaccatg gggccttccc tcaggccctg cggaggtggc
      421 tgggatccgc agggctcccc tccttcagga acgtggagtg cagtggcaca atcccagctc
      481 gctgcaacct ccgcctcccg ggttcaagtg attctcctgc ctccgcctcc caagtagctg
      541 ggattacaga agtcacctgc accggtgccc gtgacgtacg agctgcccac actgtatagg
      601 acggaggact attttcctgt ggacgccggg gaagcacagc accacccccg cacctgccct
      661 cggcctttgt gagctttgtg gtcttcccat caggaacgct ggaaagtgac attgtgtaca
      721 cactgcagct tgggggtttt tttctttgta ttgctgttta ttttatattt taaaaatatt
      781 taaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa a
//