LOCUS AK000502 831 bp mRNA linear HUM 12-SEP-2006 DEFINITION Homo sapiens cDNA FLJ20495 fis, clone KAT08572. ACCESSION AK000502 VERSION AK000502.1 KEYWORDS FLI_CDNA; oligo capping; fis (full insert sequence). SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 831) AUTHORS Sugano,S., Suzuki,Y., Ota,T., Obayashi,M., Nishi,T., Isogai,T., Shibahara,T., Tanaka,T. and Nakamura,Y. TITLE Direct Submission JOURNAL Submitted (15-FEB-2000) to the DDBJ/EMBL/GenBank databases. Contact:Sumio Sugano Institute of Medical Science, University of Tokyo, Deptment of Virology; Shirokane-dai, 4-6-1, Minato-ku, Tokyo 108-8639, Japan REFERENCE 2 AUTHORS Watanabe,K., Kumagai,A., Itakura,S., Yamazaki,M., Tashiro,H., Ota,T., Suzuki,Y., Obayashi,M., Nishi,T., Shibahara,T., Tanaka,T., Nakamura,Y., Isogai,T. and Sugano,S. TITLE NEDO human cDNA sequencing project JOURNAL Unpublished (2000) COMMENT NEDO human cDNA sequencing project supported by Ministry of International Trade and Industry of Japan; cDNA full insert sequencing: Research Association for Biotechnology; cDNA library construction, 5'- & 3'-end one pass sequencing: Departent of Virology and Human Genome Center, Institute of Medical Science, University of Tokyo (partly supported by Science and Technology Agency). FEATURES Location/Qualifiers source 1..831 /cell_line="KATO III" /cell_type="signet-ring cell carcinoma" /clone="KAT08572" /clone_lib="KAT" /db_xref="H-InvDB:HIT000002977" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector pME18SFL3" /organism="Homo sapiens" CDS 54..599 /codon_start=1 /protein_id="BAA91209.1" /translation="MLLVDADQPEPMRSGARELALFLTPEPGAEAKEVEETIEGMLLR LEEFCSLADLIRSDTSQILEENIPVLKAKLTEMRGIYAKVDRLEAFVKMVGHHVAFLE ADVLQAERDHGAFPQALRRWLGSAGLPSFRNVECSGTIPARCNLRLPGSSDSPASASQ VAGITEVTCTGARDVRAAHTV" BASE COUNT 201 a 237 c 227 g 166 t ORIGIN 1 gcaaccacgg gctcccaggc agcctccgcc agccggaccc cgtcgccctc ctgatgctgc 61 tcgtggacgc tgatcagccg gagcccatgc gcagcggggc gcgcgagctc gcgctcttcc 121 tgacccccga gcctggggcc gaggcgaagg aggtggagga gaccatcgag ggcatgctcc 181 tcaggctgga agagttttgc agcctggctg acctgatcag gagtgatact tcacagatcc 241 tggaggaaaa catcccagtc cttaaggcca aactgacaga aatgcgtggc atctatgcca 301 aagtggaccg gctagaggcc ttcgtcaaga tggttggaca ccacgtcgcc ttcctggaag 361 cagacgtgct tcaggctgag cgggaccatg gggccttccc tcaggccctg cggaggtggc 421 tgggatccgc agggctcccc tccttcagga acgtggagtg cagtggcaca atcccagctc 481 gctgcaacct ccgcctcccg ggttcaagtg attctcctgc ctccgcctcc caagtagctg 541 ggattacaga agtcacctgc accggtgccc gtgacgtacg agctgcccac actgtatagg 601 acggaggact attttcctgt ggacgccggg gaagcacagc accacccccg cacctgccct 661 cggcctttgt gagctttgtg gtcttcccat caggaacgct ggaaagtgac attgtgtaca 721 cactgcagct tgggggtttt tttctttgta ttgctgttta ttttatattt taaaaatatt 781 taaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa a //