LOCUS AJ628017 355 bp mRNA linear HUM 07-OCT-2008 DEFINITION Homo sapiens partial mRNA for human epididymal protein 2 (HE2 gene), isoform C. ACCESSION AJ628017 VERSION AJ628017.1 KEYWORDS HE2 gene; human epididymal protein 2, isoform C. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 355) AUTHORS Schaefer B. JOURNAL Submitted (17-FEB-2004) to the INSDC. Schaefer B., University of Hamburg, Inst. f. Hormone and Fertility Research, Falkenried 88, D - 20251 Hamburg, GERMANY. REFERENCE 2 AUTHORS von Horsten H.H., Derr P., Schaefer B., Kirchhoff C. TITLE SPAG11 / Isoform HE2C, an atypical anionic beta-defensin-like peptide of the proximal human epididymis JOURNAL Unpublished. FEATURES Location/Qualifiers source 1..355 /db_xref="H-InvDB:HIT000249315_04" /organism="Homo sapiens" /chromosome="8p23-p22" /mol_type="mRNA" /tissue_type="epididymis" /db_xref="taxon:9606" CDS 6..>345 /codon_start=1 /gene="HE2" /product="human epididymal protein 2" /note="isoform C" /db_xref="GOA:Q08648" /db_xref="H-InvDB:HIT000249315_03.4" /db_xref="HGNC:HGNC:14534" /db_xref="InterPro:IPR007988" /db_xref="UniProtKB/Swiss-Prot:Q08648" /experiment="experimental evidence, no additional details recorded" /protein_id="CAF31328.1" /translation="MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAP GQGTNGFQLLRHAVKRDLLPPRTPPYQEPASDLKVVDCRRSEGFCQEYCNYMETQVGY CSKKKDACCLH" sig_peptide 6..80 /gene="HE2" /experiment="experimental evidence, no additional details recorded" mat_peptide 81..>345 /gene="HE2" /product="human epididymal protein 2" /note="isoform C" /experiment="experimental evidence, no additional details recorded" BASE COUNT 100 a 98 c 82 g 75 t ORIGIN 1 tagacatgag gcaacgattg ctcccgtccg tcaccagcct tctccttgtg gccctgctgt 61 ttccaggatc gtctcaagcc agacatgtga accactcagc cactgaggct ctcggagaac 121 tcagggaaag agcccctggg caaggcacaa acgggtttca gctgctacgc cacgcagtga 181 aacgggacct cttaccaccg cgcaccccac cttaccaaga acctgcatca gatttaaaag 241 ttgttgactg caggagaagt gaaggcttct gccaagaata ctgtaattat atggaaacac 301 aagtaggcta ctgctctaaa aagaaagacg cctgctgttt acattaaaac tgatg //