LOCUS       AJ628017                 355 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens partial mRNA for human epididymal protein 2 (HE2
            gene), isoform C.
ACCESSION   AJ628017
VERSION     AJ628017.1
KEYWORDS    HE2 gene; human epididymal protein 2, isoform C.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 355)
  AUTHORS   Schaefer B.
  JOURNAL   Submitted (17-FEB-2004) to the INSDC. Schaefer B., University of
            Hamburg, Inst. f. Hormone and Fertility Research, Falkenried 88, D
            - 20251 Hamburg, GERMANY.
REFERENCE   2
  AUTHORS   von Horsten H.H., Derr P., Schaefer B., Kirchhoff C.
  TITLE     SPAG11 / Isoform HE2C, an atypical anionic beta-defensin-like
            peptide of the proximal human epididymis
  JOURNAL   Unpublished.
FEATURES             Location/Qualifiers
     source          1..355
                     /db_xref="H-InvDB:HIT000249315_04"
                     /organism="Homo sapiens"
                     /chromosome="8p23-p22"
                     /mol_type="mRNA"
                     /tissue_type="epididymis"
                     /db_xref="taxon:9606"
     CDS             6..>345
                     /codon_start=1
                     /gene="HE2"
                     /product="human epididymal protein 2"
                     /note="isoform C"
                     /db_xref="GOA:Q08648"
                     /db_xref="H-InvDB:HIT000249315_03.4"
                     /db_xref="HGNC:HGNC:14534"
                     /db_xref="InterPro:IPR007988"
                     /db_xref="UniProtKB/Swiss-Prot:Q08648"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /protein_id="CAF31328.1"
                     /translation="MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAP
                     GQGTNGFQLLRHAVKRDLLPPRTPPYQEPASDLKVVDCRRSEGFCQEYCNYMETQVGY
                     CSKKKDACCLH"
     sig_peptide     6..80
                     /gene="HE2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     mat_peptide     81..>345
                     /gene="HE2"
                     /product="human epididymal protein 2"
                     /note="isoform C"
                     /experiment="experimental evidence, no additional details
                     recorded"
BASE COUNT          100 a           98 c           82 g           75 t
ORIGIN      
        1 tagacatgag gcaacgattg ctcccgtccg tcaccagcct tctccttgtg gccctgctgt
       61 ttccaggatc gtctcaagcc agacatgtga accactcagc cactgaggct ctcggagaac
      121 tcagggaaag agcccctggg caaggcacaa acgggtttca gctgctacgc cacgcagtga
      181 aacgggacct cttaccaccg cgcaccccac cttaccaaga acctgcatca gatttaaaag
      241 ttgttgactg caggagaagt gaaggcttct gccaagaata ctgtaattat atggaaacac
      301 aagtaggcta ctgctctaaa aagaaagacg cctgctgttt acattaaaac tgatg
//