LOCUS       AJ437024                 513 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for p19 H-RasIDX protein (H-RAS gene).
ACCESSION   AJ437024
VERSION     AJ437024.1
KEYWORDS    H-RAS gene; p19 H-RasIDX protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 513)
  AUTHORS   Bach-Elias M.
  JOURNAL   Submitted (22-FEB-2002) to the INSDC. Bach-Elias M., Molecular
            Pathology and Therapeutics, IIBB-CSIC, c/Jorge Girona Salgado
            18-26, 08034 Barcelona, SPAIN.
REFERENCE   2
  AUTHORS   Guil S., de La Iglesia N., Fernandez-Larrea J., Cifuentes D.,
            Ferrer J.C., Guinovart J.J., Bach-Elias M.
  TITLE     Alternative splicing of the human proto-oncogene c-H-ras renders a
            new Ras family protein that trafficks to cytoplasm and nucleus
  JOURNAL   Cancer Res. 63(17), 5178-5187(2003).
   PUBMED   14500341
FEATURES             Location/Qualifiers
     source          1..513
                     /db_xref="H-InvDB:HIT000248003"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_line="HeLa S3"
                     /db_xref="taxon:9606"
     CDS             1..513
                     /gene="H-RAS"
                     /product="p19 H-RasIDX protein"
                     /db_xref="GOA:P01112"
                     /db_xref="H-InvDB:HIT000248003.11"
                     /db_xref="HGNC:HGNC:5173"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PDB:121P"
                     /db_xref="PDB:1AA9"
                     /db_xref="PDB:1AGP"
                     /db_xref="PDB:1BKD"
                     /db_xref="PDB:1CLU"
                     /db_xref="PDB:1CRP"
                     /db_xref="PDB:1CRQ"
                     /db_xref="PDB:1CRR"
                     /db_xref="PDB:1CTQ"
                     /db_xref="PDB:1GNP"
                     /db_xref="PDB:1GNQ"
                     /db_xref="PDB:1GNR"
                     /db_xref="PDB:1HE8"
                     /db_xref="PDB:1IAQ"
                     /db_xref="PDB:1IOZ"
                     /db_xref="PDB:1JAH"
                     /db_xref="PDB:1JAI"
                     /db_xref="PDB:1K8R"
                     /db_xref="PDB:1LF0"
                     /db_xref="PDB:1LF5"
                     /db_xref="PDB:1LFD"
                     /db_xref="PDB:1NVU"
                     /db_xref="PDB:1NVV"
                     /db_xref="PDB:1NVW"
                     /db_xref="PDB:1NVX"
                     /db_xref="PDB:1P2S"
                     /db_xref="PDB:1P2T"
                     /db_xref="PDB:1P2U"
                     /db_xref="PDB:1P2V"
                     /db_xref="PDB:1PLJ"
                     /db_xref="PDB:1PLK"
                     /db_xref="PDB:1PLL"
                     /db_xref="PDB:1Q21"
                     /db_xref="PDB:1QRA"
                     /db_xref="PDB:1RVD"
                     /db_xref="PDB:1WQ1"
                     /db_xref="PDB:1XCM"
                     /db_xref="PDB:1XD2"
                     /db_xref="PDB:1XJ0"
                     /db_xref="PDB:1ZVQ"
                     /db_xref="PDB:1ZW6"
                     /db_xref="PDB:221P"
                     /db_xref="PDB:2C5L"
                     /db_xref="PDB:2CE2"
                     /db_xref="PDB:2CL0"
                     /db_xref="PDB:2CL6"
                     /db_xref="PDB:2CL7"
                     /db_xref="PDB:2CLC"
                     /db_xref="PDB:2CLD"
                     /db_xref="PDB:2EVW"
                     /db_xref="PDB:2GDP"
                     /db_xref="PDB:2LCF"
                     /db_xref="PDB:2LWI"
                     /db_xref="PDB:2N42"
                     /db_xref="PDB:2N46"
                     /db_xref="PDB:2Q21"
                     /db_xref="PDB:2QUZ"
                     /db_xref="PDB:2RGA"
                     /db_xref="PDB:2RGB"
                     /db_xref="PDB:2RGC"
                     /db_xref="PDB:2RGD"
                     /db_xref="PDB:2RGE"
                     /db_xref="PDB:2RGG"
                     /db_xref="PDB:2UZI"
                     /db_xref="PDB:2VH5"
                     /db_xref="PDB:2X1V"
                     /db_xref="PDB:3DDC"
                     /db_xref="PDB:3I3S"
                     /db_xref="PDB:3K8Y"
                     /db_xref="PDB:3K9L"
                     /db_xref="PDB:3K9N"
                     /db_xref="PDB:3KKM"
                     /db_xref="PDB:3KKN"
                     /db_xref="PDB:3KUD"
                     /db_xref="PDB:3L8Y"
                     /db_xref="PDB:3L8Z"
                     /db_xref="PDB:3LBH"
                     /db_xref="PDB:3LBI"
                     /db_xref="PDB:3LBN"
                     /db_xref="PDB:3LO5"
                     /db_xref="PDB:3OIU"
                     /db_xref="PDB:3OIV"
                     /db_xref="PDB:3OIW"
                     /db_xref="PDB:3RRY"
                     /db_xref="PDB:3RRZ"
                     /db_xref="PDB:3RS0"
                     /db_xref="PDB:3RS2"
                     /db_xref="PDB:3RS3"
                     /db_xref="PDB:3RS4"
                     /db_xref="PDB:3RS5"
                     /db_xref="PDB:3RS7"
                     /db_xref="PDB:3RSL"
                     /db_xref="PDB:3RSO"
                     /db_xref="PDB:3TGP"
                     /db_xref="PDB:421P"
                     /db_xref="PDB:4DLR"
                     /db_xref="PDB:4DLS"
                     /db_xref="PDB:4DLT"
                     /db_xref="PDB:4DLU"
                     /db_xref="PDB:4DLV"
                     /db_xref="PDB:4DLW"
                     /db_xref="PDB:4DLX"
                     /db_xref="PDB:4DLY"
                     /db_xref="PDB:4DLZ"
                     /db_xref="PDB:4DST"
                     /db_xref="PDB:4DSU"
                     /db_xref="PDB:4EFL"
                     /db_xref="PDB:4EFM"
                     /db_xref="PDB:4EFN"
                     /db_xref="PDB:4G0N"
                     /db_xref="PDB:4G3X"
                     /db_xref="PDB:4K81"
                     /db_xref="PDB:4L9S"
                     /db_xref="PDB:4L9W"
                     /db_xref="PDB:4NYI"
                     /db_xref="PDB:4NYJ"
                     /db_xref="PDB:4NYM"
                     /db_xref="PDB:4Q21"
                     /db_xref="PDB:4RSG"
                     /db_xref="PDB:4URU"
                     /db_xref="PDB:4URV"
                     /db_xref="PDB:4URW"
                     /db_xref="PDB:4URX"
                     /db_xref="PDB:4URY"
                     /db_xref="PDB:4URZ"
                     /db_xref="PDB:4US0"
                     /db_xref="PDB:4US1"
                     /db_xref="PDB:4US2"
                     /db_xref="PDB:4XVQ"
                     /db_xref="PDB:4XVR"
                     /db_xref="PDB:521P"
                     /db_xref="PDB:5B2Z"
                     /db_xref="PDB:5B30"
                     /db_xref="PDB:5E95"
                     /db_xref="PDB:5P21"
                     /db_xref="PDB:5VBE"
                     /db_xref="PDB:5VBZ"
                     /db_xref="PDB:5WDO"
                     /db_xref="PDB:5WDP"
                     /db_xref="PDB:5WDQ"
                     /db_xref="PDB:5WFO"
                     /db_xref="PDB:5WFP"
                     /db_xref="PDB:5WFQ"
                     /db_xref="PDB:5WFR"
                     /db_xref="PDB:5WPL"
                     /db_xref="PDB:5X9S"
                     /db_xref="PDB:5ZC6"
                     /db_xref="PDB:621P"
                     /db_xref="PDB:6AMB"
                     /db_xref="PDB:6AXG"
                     /db_xref="PDB:6BVI"
                     /db_xref="PDB:6BVJ"
                     /db_xref="PDB:6BVK"
                     /db_xref="PDB:6BVL"
                     /db_xref="PDB:6BVM"
                     /db_xref="PDB:6CUO"
                     /db_xref="PDB:6CUP"
                     /db_xref="PDB:6CUR"
                     /db_xref="PDB:6D55"
                     /db_xref="PDB:6D56"
                     /db_xref="PDB:6D59"
                     /db_xref="PDB:6D5E"
                     /db_xref="PDB:6D5G"
                     /db_xref="PDB:6D5H"
                     /db_xref="PDB:6D5J"
                     /db_xref="PDB:6D5L"
                     /db_xref="PDB:6D5M"
                     /db_xref="PDB:6D5V"
                     /db_xref="PDB:6D5W"
                     /db_xref="PDB:6DZH"
                     /db_xref="PDB:6Q21"
                     /db_xref="PDB:721P"
                     /db_xref="PDB:821P"
                     /db_xref="UniProtKB/Swiss-Prot:P01112"
                     /protein_id="CAD24594.1"
                     /translation="MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQV
                     VIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKR
                     VKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSSSSS
                     GTLWDPPGPM"
BASE COUNT          111 a          145 c          165 g           92 t
ORIGIN      
        1 atgacggaat ataagctggt ggtggtgggc gccggcggtg tgggcaagag tgcgctgacc
       61 atccagctga tccagaacca ttttgtggac gaatacgacc ccactataga ggattcctac
      121 cggaagcagg tggtcattga tggggagacg tgcctgttgg acatcctgga taccgccggc
      181 caggaggagt acagcgccat gcgggaccag tacatgcgca ccggggaggg cttcctgtgt
      241 gtgtttgcca tcaacaacac caagtctttt gaggacatcc accagtacag ggagcagatc
      301 aaacgggtga aggactcgga tgacgtgccc atggtgctgg tggggaacaa gtgtgacctg
      361 gctgcacgca ctgtggaatc tcggcaggct caggacctcg cccgaagcta cggcatcccc
      421 tacatcgaga cctcggccaa gacccggcag ggcagccgct ctggctctag ctccagctcc
      481 gggaccctct gggacccccc gggacccatg tga
//