LOCUS AJ306405 512 bp mRNA linear HUM 07-OCT-2008 DEFINITION Homo sapiens mRNA for liver-expressed antimicrobial peptide 2 (LEAP-2 gene). ACCESSION AJ306405 VERSION AJ306405.1 KEYWORDS LEAP-2 gene; liver-expressed antimicrobial peptide 2. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 512) AUTHORS Krause A. JOURNAL Submitted (15-FEB-2001) to the INSDC. Krause A., Molecular Biology, IPF Pharmaceuticals GmbH, Feodor-Lynen-Str. 31, Hannover, Lower Saxony, D-30625, GERMANY. REFERENCE 2 AUTHORS Krause A., Sillard R., Kleemier B., Kluver E., Maronde E., Conejo-Garcia J.R., Forssman W.G., Schulz-Knappe P., Nehls M.C., Wattler F., Wattler F., Adermann K. TITLE Isolation and biochemical characterization of LEAP-2, a novel blood peptide expressed in the liver JOURNAL Protein Sci. 12(1), 143-152(2003). PUBMED 12493837 FEATURES Location/Qualifiers source 1..512 /db_xref="H-InvDB:HIT000246930" /organism="Homo sapiens" /chromosome="5" /map="5q31" /mol_type="mRNA" /dev_stage="adult" /clone_lib="RT-PCR fragments in pGEM" /tissue_type="liver" /db_xref="taxon:9606" CDS 30..263 /gene="LEAP-2" /product="liver-expressed antimicrobial peptide 2" /db_xref="GOA:Q969E1" /db_xref="H-InvDB:HIT000246930.13" /db_xref="HGNC:HGNC:29571" /db_xref="InterPro:IPR009955" /db_xref="PDB:2L1Q" /db_xref="UniProtKB/Swiss-Prot:Q969E1" /experiment="experimental evidence, no additional details recorded" /protein_id="CAC51306.1" /translation="MWHLKLCAVLMIFLLLLGQIDGSPIPEVSSAKRRPRRMTPFWRG VSLRPIGASCRDDSECITRLCRKRRCSLSVAQE" sig_peptide 30..95 /gene="LEAP-2" mat_peptide 141..260 /gene="LEAP-2" /product="liver-expressed antimicrobial peptide 2" /experiment="experimental evidence, no additional details recorded" regulatory 495..500 /regulatory_class="polyA_signal_sequence" BASE COUNT 141 a 108 c 114 g 149 t ORIGIN 1 tcaggctcca acatcctccc cctgtcaaga tgtggcacct caaactttgt gcagtcctca 61 tgatcttcct gttgctgttg ggccagatag atggctcccc aataccagaa gtgagttcgg 121 caaagagaag gccacggaga atgaccccat tttggagagg ggtttccctc aggcctattg 181 gagcctcctg ccgggatgat tctgagtgta tcacaaggct atgcagaaaa agacgctgtt 241 ccttaagtgt ggcccaggaa tgatgtacat accagggaaa gaaaggacag cagtcacctc 301 cgacaatgct ccgttctatg gaatattgat taactgcatt ttggctggag acacccaagt 361 gaagcaatct tgtattttta atatttaaag gcagatgtac gctttaaatt ggtctccatt 421 tcttcttaga atgttgatat atggataagc ataactaaac ttgtcaattt agagtttatt 481 tttctatgga tactattaaa tgtctcaaat tg //