LOCUS       AJ306405                 512 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for liver-expressed antimicrobial peptide 2
            (LEAP-2 gene).
ACCESSION   AJ306405
VERSION     AJ306405.1
KEYWORDS    LEAP-2 gene; liver-expressed antimicrobial peptide 2.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 512)
  AUTHORS   Krause A.
  JOURNAL   Submitted (15-FEB-2001) to the INSDC. Krause A., Molecular Biology,
            IPF Pharmaceuticals GmbH, Feodor-Lynen-Str. 31, Hannover, Lower
            Saxony, D-30625, GERMANY.
REFERENCE   2
  AUTHORS   Krause A., Sillard R., Kleemier B., Kluver E., Maronde E.,
            Conejo-Garcia J.R., Forssman W.G., Schulz-Knappe P., Nehls M.C.,
            Wattler F., Wattler F., Adermann K.
  TITLE     Isolation and biochemical characterization of LEAP-2, a novel blood
            peptide expressed in the liver
  JOURNAL   Protein Sci. 12(1), 143-152(2003).
   PUBMED   12493837
FEATURES             Location/Qualifiers
     source          1..512
                     /db_xref="H-InvDB:HIT000246930"
                     /organism="Homo sapiens"
                     /chromosome="5"
                     /map="5q31"
                     /mol_type="mRNA"
                     /dev_stage="adult"
                     /clone_lib="RT-PCR fragments in pGEM"
                     /tissue_type="liver"
                     /db_xref="taxon:9606"
     CDS             30..263
                     /gene="LEAP-2"
                     /product="liver-expressed antimicrobial peptide 2"
                     /db_xref="GOA:Q969E1"
                     /db_xref="H-InvDB:HIT000246930.13"
                     /db_xref="HGNC:HGNC:29571"
                     /db_xref="InterPro:IPR009955"
                     /db_xref="PDB:2L1Q"
                     /db_xref="UniProtKB/Swiss-Prot:Q969E1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /protein_id="CAC51306.1"
                     /translation="MWHLKLCAVLMIFLLLLGQIDGSPIPEVSSAKRRPRRMTPFWRG
                     VSLRPIGASCRDDSECITRLCRKRRCSLSVAQE"
     sig_peptide     30..95
                     /gene="LEAP-2"
     mat_peptide     141..260
                     /gene="LEAP-2"
                     /product="liver-expressed antimicrobial peptide 2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      495..500
                     /regulatory_class="polyA_signal_sequence"
BASE COUNT          141 a          108 c          114 g          149 t
ORIGIN      
        1 tcaggctcca acatcctccc cctgtcaaga tgtggcacct caaactttgt gcagtcctca
       61 tgatcttcct gttgctgttg ggccagatag atggctcccc aataccagaa gtgagttcgg
      121 caaagagaag gccacggaga atgaccccat tttggagagg ggtttccctc aggcctattg
      181 gagcctcctg ccgggatgat tctgagtgta tcacaaggct atgcagaaaa agacgctgtt
      241 ccttaagtgt ggcccaggaa tgatgtacat accagggaaa gaaaggacag cagtcacctc
      301 cgacaatgct ccgttctatg gaatattgat taactgcatt ttggctggag acacccaagt
      361 gaagcaatct tgtattttta atatttaaag gcagatgtac gctttaaatt ggtctccatt
      421 tcttcttaga atgttgatat atggataagc ataactaaac ttgtcaattt agagtttatt
      481 tttctatgga tactattaaa tgtctcaaat tg
//