LOCUS       AJ251026                 676 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for putative odorant binding protein b-a (OBPIIb
            gene).
ACCESSION   AJ251026
VERSION     AJ251026.1
KEYWORDS    OBPIIb gene; odorant binding protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   2  (bases 1 to 676)
  AUTHORS   Gachon A.M.
  JOURNAL   Submitted (26-OCT-1999) to the INSDC. Laboratoire de Biochimie
            Medicale - INSERM U384, Universite d'Auvergne - Faculte de
            Medecine, 28, place Henri Dunant, Clermont Ferrand cedex01 63001,
            FRANCE.
REFERENCE   3
  AUTHORS   Lacazette E., Gachon A.M., Pitiot G.
  TITLE     A novel human odorant-binding protein gene family resulting from
            genomic duplicons at 9q34: differential expression in the oral and
            genital spheres
  JOURNAL   Hum. Mol. Genet. 9(2), 289-301(2000).
   PUBMED   10607840
FEATURES             Location/Qualifiers
     source          1..676
                     /db_xref="H-InvDB:HIT000245989"
                     /organism="Homo sapiens"
                     /chromosome="9"
                     /map="9q34"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             43..555
                     /gene="OBPIIb"
                     /product="putative odorant-binding protein b-a"
                     /db_xref="GOA:Q9NPH6"
                     /db_xref="H-InvDB:HIT000245989.13"
                     /db_xref="HGNC:HGNC:23381"
                     /db_xref="InterPro:IPR000566"
                     /db_xref="InterPro:IPR002345"
                     /db_xref="InterPro:IPR002450"
                     /db_xref="InterPro:IPR012674"
                     /db_xref="UniProtKB/Swiss-Prot:Q9NPH6"
                     /protein_id="CAB71323.1"
                     /translation="MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDR
                     RPRKVSPVKVTALGGGKLEATFTFMREDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQ
                     ELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREALEEFKKLVQRKGLSEEDIFTP
                     LQTGSCVPEH"
BASE COUNT          160 a          200 c          204 g          112 t
ORIGIN      
        1 cgcccagtga cctgccgagg tcggcagcac agagctctgg agatgaagac cctgttcctg
       61 ggtgtcacgc tcggcctggc cgctgccctg tccttcaccc tggaggagga ggatatcaca
      121 gggacctggt acgtgaaggc catggtggtc gataaggact ttccggagga caggaggccc
      181 aggaaggtgt ccccagtgaa ggtgacagcc ctgggcggtg ggaagttgga agccacgttc
      241 accttcatga gggaggatcg gtgcatccag aagaaaatcc tgatgcggaa gacggaggag
      301 cctggcaaat acagcgccta tgggggcagg aagctcatgt acctgcagga gctgcccagg
      361 agggaccact acatctttta ctgcaaagac cagcaccatg ggggcctgct ccacatggga
      421 aagcttgtgg gtaggaattc tgataccaac cgggaggccc tggaagaatt taagaaattg
      481 gtgcagcgca agggactctc ggaggaggac attttcacgc ccctgcagac gggaagctgc
      541 gttcccgaac actaggcagc ccccgggtct gcacctccag agcccaccct accaccagac
      601 acagagcccg gaccacctgg acctaccctc cagccatgac ccttccctgc tcccacccac
      661 ctgactccaa ataaag
//