LOCUS AJ251026 676 bp mRNA linear HUM 07-OCT-2008 DEFINITION Homo sapiens mRNA for putative odorant binding protein b-a (OBPIIb gene). ACCESSION AJ251026 VERSION AJ251026.1 KEYWORDS OBPIIb gene; odorant binding protein. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 2 (bases 1 to 676) AUTHORS Gachon A.M. JOURNAL Submitted (26-OCT-1999) to the INSDC. Laboratoire de Biochimie Medicale - INSERM U384, Universite d'Auvergne - Faculte de Medecine, 28, place Henri Dunant, Clermont Ferrand cedex01 63001, FRANCE. REFERENCE 3 AUTHORS Lacazette E., Gachon A.M., Pitiot G. TITLE A novel human odorant-binding protein gene family resulting from genomic duplicons at 9q34: differential expression in the oral and genital spheres JOURNAL Hum. Mol. Genet. 9(2), 289-301(2000). PUBMED 10607840 FEATURES Location/Qualifiers source 1..676 /db_xref="H-InvDB:HIT000245989" /organism="Homo sapiens" /chromosome="9" /map="9q34" /mol_type="mRNA" /db_xref="taxon:9606" CDS 43..555 /gene="OBPIIb" /product="putative odorant-binding protein b-a" /db_xref="GOA:Q9NPH6" /db_xref="H-InvDB:HIT000245989.13" /db_xref="HGNC:HGNC:23381" /db_xref="InterPro:IPR000566" /db_xref="InterPro:IPR002345" /db_xref="InterPro:IPR002450" /db_xref="InterPro:IPR012674" /db_xref="UniProtKB/Swiss-Prot:Q9NPH6" /protein_id="CAB71323.1" /translation="MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDR RPRKVSPVKVTALGGGKLEATFTFMREDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQ ELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREALEEFKKLVQRKGLSEEDIFTP LQTGSCVPEH" BASE COUNT 160 a 200 c 204 g 112 t ORIGIN 1 cgcccagtga cctgccgagg tcggcagcac agagctctgg agatgaagac cctgttcctg 61 ggtgtcacgc tcggcctggc cgctgccctg tccttcaccc tggaggagga ggatatcaca 121 gggacctggt acgtgaaggc catggtggtc gataaggact ttccggagga caggaggccc 181 aggaaggtgt ccccagtgaa ggtgacagcc ctgggcggtg ggaagttgga agccacgttc 241 accttcatga gggaggatcg gtgcatccag aagaaaatcc tgatgcggaa gacggaggag 301 cctggcaaat acagcgccta tgggggcagg aagctcatgt acctgcagga gctgcccagg 361 agggaccact acatctttta ctgcaaagac cagcaccatg ggggcctgct ccacatggga 421 aagcttgtgg gtaggaattc tgataccaac cgggaggccc tggaagaatt taagaaattg 481 gtgcagcgca agggactctc ggaggaggac attttcacgc ccctgcagac gggaagctgc 541 gttcccgaac actaggcagc ccccgggtct gcacctccag agcccaccct accaccagac 601 acagagcccg gaccacctgg acctaccctc cagccatgac ccttccctgc tcccacccac 661 ctgactccaa ataaag //