LOCUS       AJ249975                 307 bp    mRNA    linear   HUM 25-JUL-2000
DEFINITION  Homo sapiens partial mRNA for ankyrin repeat domain 2 (stretch
            responsive muscle).
ACCESSION   AJ249975
VERSION     AJ249975.1
KEYWORDS    Ankrd2 gene; ankyrin repeat domain 2; stretch responsive muscle.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 307)
  AUTHORS   Kemp T.J.
  JOURNAL   Submitted (13-OCT-1999) to the INSDC. Kemp T.J., Molecular
            Pathology, Imperial College School OF Medicine, SAF Building Level
            2, Exhibition Road, South Kensington, London, UNITED KINGDOM.
REFERENCE   2
  AUTHORS   Kemp T.J., Sadusky T.J., Saltisi F., Carey N., Moss J., Yang S.Y.,
            Sassoon D.A., Goldspink G., Coulton G.R.
  TITLE     Identification of Ankrd2, a novel skeletal muscle gene coding for a
            stretch-responsive ankyrin-repeat protein
  JOURNAL   Genomics 66(3), 229-241(2000).
   PUBMED   10873377
COMMENT     Related sequence: AJ245514
FEATURES             Location/Qualifiers
     source          1..307
                     /db_xref="H-InvDB:HIT000245956"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /tissue_type="skeletal muscle"
                     /db_xref="taxon:9606"
     CDS             <1..>307
                     /codon_start=2
                     /gene="ANKRD2"
                     /product="ankyrin repeat domain 2"
                     /note="stretch responsive muscle"
                     /db_xref="GOA:Q9GZV1"
                     /db_xref="H-InvDB:HIT000245956.12"
                     /db_xref="HGNC:HGNC:495"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="UniProtKB/Swiss-Prot:Q9GZV1"
                     /protein_id="CAB99416.1"
                     /translation="SAQEEENEKLRGDXRQKLPMDLLVLEDEKHHGAQSAALQKVKGQ
                     ERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEE
                     "
BASE COUNT           76 a           82 c          110 g           38 t
ORIGIN      
        1 ttctgcacag gaggaggaga atgagaaact ccgaggagac ncacgccaga agctgcccat
       61 ggacttgctg gtgctggagg atgagaagca ccacggggct cagagtgcag ccctgcagaa
      121 ggtgaagggc caagagcgcg tgcgcaagac gtccctggac ctgcggcggg agatcatcga
      181 tgtgggcggg atccagaacc tcatcgagct gcggaagaaa cgcaagcaga agaagcggga
      241 cgctctggcc gcctcgcatg agccgccccc agagcccgag gagatcactg gccctgtgga
      301 tgaggag
//