LOCUS AJ249975 307 bp mRNA linear HUM 25-JUL-2000 DEFINITION Homo sapiens partial mRNA for ankyrin repeat domain 2 (stretch responsive muscle). ACCESSION AJ249975 VERSION AJ249975.1 KEYWORDS Ankrd2 gene; ankyrin repeat domain 2; stretch responsive muscle. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 307) AUTHORS Kemp T.J. JOURNAL Submitted (13-OCT-1999) to the INSDC. Kemp T.J., Molecular Pathology, Imperial College School OF Medicine, SAF Building Level 2, Exhibition Road, South Kensington, London, UNITED KINGDOM. REFERENCE 2 AUTHORS Kemp T.J., Sadusky T.J., Saltisi F., Carey N., Moss J., Yang S.Y., Sassoon D.A., Goldspink G., Coulton G.R. TITLE Identification of Ankrd2, a novel skeletal muscle gene coding for a stretch-responsive ankyrin-repeat protein JOURNAL Genomics 66(3), 229-241(2000). PUBMED 10873377 COMMENT Related sequence: AJ245514 FEATURES Location/Qualifiers source 1..307 /db_xref="H-InvDB:HIT000245956" /organism="Homo sapiens" /mol_type="mRNA" /tissue_type="skeletal muscle" /db_xref="taxon:9606" CDS <1..>307 /codon_start=2 /gene="ANKRD2" /product="ankyrin repeat domain 2" /note="stretch responsive muscle" /db_xref="GOA:Q9GZV1" /db_xref="H-InvDB:HIT000245956.12" /db_xref="HGNC:HGNC:495" /db_xref="InterPro:IPR002110" /db_xref="InterPro:IPR020683" /db_xref="InterPro:IPR036770" /db_xref="UniProtKB/Swiss-Prot:Q9GZV1" /protein_id="CAB99416.1" /translation="SAQEEENEKLRGDXRQKLPMDLLVLEDEKHHGAQSAALQKVKGQ ERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEE " BASE COUNT 76 a 82 c 110 g 38 t ORIGIN 1 ttctgcacag gaggaggaga atgagaaact ccgaggagac ncacgccaga agctgcccat 61 ggacttgctg gtgctggagg atgagaagca ccacggggct cagagtgcag ccctgcagaa 121 ggtgaagggc caagagcgcg tgcgcaagac gtccctggac ctgcggcggg agatcatcga 181 tgtgggcggg atccagaacc tcatcgagct gcggaagaaa cgcaagcaga agaagcggga 241 cgctctggcc gcctcgcatg agccgccccc agagcccgag gagatcactg gccctgtgga 301 tgaggag //