LOCUS       AJ244513                 400 bp    DNA     linear   HUM 29-APR-2000
DEFINITION  Homo sapiens LPHH1 gene, exon 18.1.
ACCESSION   AJ244513
VERSION     AJ244513.1
KEYWORDS    alternative splicing; latrophilin-2; lphh1 gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 400)
  AUTHORS   Heighway J.
  JOURNAL   Submitted (05-MAY-1999) to the INSDC. Heighway J., Molecular
            Genetics, Paterson Institute for Cancer Research, Wilmslow Road,
            Manchester, M20 9BX, UNITED KINGDOM.
REFERENCE   2
  AUTHORS   White G.R.M., Varley J.M., Heighway J.
  TITLE     Isolation and characterization of a human homologue of the
            latrophilin gene from a region of 1p31.1 implicated in breast
            cancer
  JOURNAL   Oncogene 17(26), 3513-3519(1998).
   PUBMED   10030676
REFERENCE   4
  AUTHORS   White G.R.M., Varley J.M., Heighway J.
  TITLE     Genomic structure and expression profile of LPHH1, a 7TM gene
            variably expressed in breast cancer cell lines
  JOURNAL   Biochim. Biophys. Acta 1491(1-3), 75-92(2000).
   PUBMED   10760572
COMMENT     Related sequence: AJ131581
FEATURES             Location/Qualifiers
     source          1..400
                     /db_xref="H-InvDB:HIT000384072"
                     /organism="Homo sapiens"
                     /chromosome="1"
                     /map="1p31.1"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9606"
     CDS             <142..>270
                     /codon_start=3
                     /gene="LPHH1"
                     /product="latrophilin-2"
                     /note="alternative exon, domain D"
                     /db_xref="GOA:Q9UJ49"
                     /db_xref="H-InvDB:HIT000384072.6"
                     /db_xref="InterPro:IPR003334"
                     /db_xref="InterPro:IPR031240"
                     /db_xref="UniProtKB/TrEMBL:Q9UJ49"
                     /protein_id="CAB60205.1"
                     /translation="MTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPVFNSP"
     exon            142..270
                     /gene="LPHH1"
                     /note="number 18.1"
                     /note="alternative exon, domain D"
BASE COUNT          119 a           87 c           49 g          140 t
ORIGIN      
        1 acatttnaac agattttcca ttgccaactt gnccnctacc cttgatgaat ataaaaaaaa
       61 tagttgacta caactgtaac nctaaaataa gnaactgatg acttttctct ggttttttgg
      121 tggttttttt ttttacttta ggaatgactg gcaattacct actaacaaac cctcttcttc
      181 gaccccacgg cactaacaac ccctataaca cattgctcgc tgaaacagtt gtatgtaatg
      241 ccccttcagc tcctgtattt aactcaccag gtgtgcttta cttacaaata aaactacctt
      301 tctttgctgc taaacagagc tatgatcttt gccctgtttc taaaatattc aagttgtcat
      361 atatttattg ttacattctt aatttctcag ttaaaaaaaa
//