LOCUS AJ244513 400 bp DNA linear HUM 29-APR-2000 DEFINITION Homo sapiens LPHH1 gene, exon 18.1. ACCESSION AJ244513 VERSION AJ244513.1 KEYWORDS alternative splicing; latrophilin-2; lphh1 gene. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 400) AUTHORS Heighway J. JOURNAL Submitted (05-MAY-1999) to the INSDC. Heighway J., Molecular Genetics, Paterson Institute for Cancer Research, Wilmslow Road, Manchester, M20 9BX, UNITED KINGDOM. REFERENCE 2 AUTHORS White G.R.M., Varley J.M., Heighway J. TITLE Isolation and characterization of a human homologue of the latrophilin gene from a region of 1p31.1 implicated in breast cancer JOURNAL Oncogene 17(26), 3513-3519(1998). PUBMED 10030676 REFERENCE 4 AUTHORS White G.R.M., Varley J.M., Heighway J. TITLE Genomic structure and expression profile of LPHH1, a 7TM gene variably expressed in breast cancer cell lines JOURNAL Biochim. Biophys. Acta 1491(1-3), 75-92(2000). PUBMED 10760572 COMMENT Related sequence: AJ131581 FEATURES Location/Qualifiers source 1..400 /db_xref="H-InvDB:HIT000384072" /organism="Homo sapiens" /chromosome="1" /map="1p31.1" /mol_type="genomic DNA" /db_xref="taxon:9606" CDS <142..>270 /codon_start=3 /gene="LPHH1" /product="latrophilin-2" /note="alternative exon, domain D" /db_xref="GOA:Q9UJ49" /db_xref="H-InvDB:HIT000384072.6" /db_xref="InterPro:IPR003334" /db_xref="InterPro:IPR031240" /db_xref="UniProtKB/TrEMBL:Q9UJ49" /protein_id="CAB60205.1" /translation="MTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPVFNSP" exon 142..270 /gene="LPHH1" /note="number 18.1" /note="alternative exon, domain D" BASE COUNT 119 a 87 c 49 g 140 t ORIGIN 1 acatttnaac agattttcca ttgccaactt gnccnctacc cttgatgaat ataaaaaaaa 61 tagttgacta caactgtaac nctaaaataa gnaactgatg acttttctct ggttttttgg 121 tggttttttt ttttacttta ggaatgactg gcaattacct actaacaaac cctcttcttc 181 gaccccacgg cactaacaac ccctataaca cattgctcgc tgaaacagtt gtatgtaatg 241 ccccttcagc tcctgtattt aactcaccag gtgtgcttta cttacaaata aaactacctt 301 tctttgctgc taaacagagc tatgatcttt gccctgtttc taaaatattc aagttgtcat 361 atatttattg ttacattctt aatttctcag ttaaaaaaaa //