LOCUS AJ237673 337 bp mRNA linear HUM 07-OCT-2008 DEFINITION Homo sapiens mRNA for beta-defensin-3. ACCESSION AJ237673 VERSION AJ237673.1 KEYWORDS BD-3 gene; beta-defensin-3. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 337) AUTHORS Harder J. JOURNAL Submitted (26-MAR-1999) to the INSDC. Harder J., Department of Dermatology, University of Kiel, Schittemhelmstr. 7, 24105 Kiel, GERMANY. REMARK revised by submitter 14-MAY-99 REFERENCE 2 AUTHORS Harder J., Bartels J., Christophers E., Schroeder J.M. TITLE Isolation and characterization of human beta -defensin-3, a novel human inducible peptide antibiotic JOURNAL J Biol Chem 276(8), 5707-5713(2001). PUBMED 11085990 FEATURES Location/Qualifiers source 1..337 /db_xref="H-InvDB:HIT000245218_04" /organism="Homo sapiens" /mol_type="mRNA" /cell_type="keratinocyte" /db_xref="taxon:9606" CDS 33..236 /gene="BD-3" /product="beta-defensin-3" /function="antimicrobial" /db_xref="GOA:P81534" /db_xref="H-InvDB:HIT000245218_03.4" /db_xref="HGNC:HGNC:15967" /db_xref="HGNC:HGNC:31702" /db_xref="InterPro:IPR001855" /db_xref="PDB:1KJ6" /db_xref="UniProtKB/Swiss-Prot:P81534" /protein_id="CAC03097.1" /translation="MRIHYLLFALLFLFLVPVPGHGGIINTLQKYYCRVRGGRCAVLS CLPKEEQIGKCSTRGRKCCRRKK" sig_peptide 33..98 /gene="BD-3" mat_peptide 99..233 /gene="BD-3" /product="beta-defensin-3" /experiment="experimental evidence, no additional details recorded" BASE COUNT 105 a 62 c 80 g 90 t ORIGIN 1 tgagtctcag cgtggggtga agcctagcag ctatgaggat ccattatctt ctgtttgctt 61 tgctcttcct gtttttggtg cctgtcccag gtcatggagg aatcataaac acattacaga 121 aatattattg cagagtcaga ggcggccggt gtgctgtgct cagctgcctt ccaaaggagg 181 aacagatcgg caagtgctcg acgcgtggcc gaaaatgctg ccgaagaaag aaataaaaac 241 cctgaaacat gacgagagtg ttgtaaagtg tggaaatgcc ttcttaaagt ttataaaagt 301 aaaatcaaat tacatttttt tttcaaaaaa aaaaaaa //