LOCUS       AJ237673                 337 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for beta-defensin-3.
ACCESSION   AJ237673
VERSION     AJ237673.1
KEYWORDS    BD-3 gene; beta-defensin-3.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 337)
  AUTHORS   Harder J.
  JOURNAL   Submitted (26-MAR-1999) to the INSDC. Harder J., Department of
            Dermatology, University of Kiel, Schittemhelmstr. 7, 24105 Kiel,
            GERMANY.
  REMARK    revised by submitter 14-MAY-99
REFERENCE   2
  AUTHORS   Harder J., Bartels J., Christophers E., Schroeder J.M.
  TITLE     Isolation and characterization of human beta -defensin-3, a novel
            human inducible peptide antibiotic
  JOURNAL   J Biol Chem 276(8), 5707-5713(2001).
   PUBMED   11085990
FEATURES             Location/Qualifiers
     source          1..337
                     /db_xref="H-InvDB:HIT000245218_04"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_type="keratinocyte"
                     /db_xref="taxon:9606"
     CDS             33..236
                     /gene="BD-3"
                     /product="beta-defensin-3"
                     /function="antimicrobial"
                     /db_xref="GOA:P81534"
                     /db_xref="H-InvDB:HIT000245218_03.4"
                     /db_xref="HGNC:HGNC:15967"
                     /db_xref="HGNC:HGNC:31702"
                     /db_xref="InterPro:IPR001855"
                     /db_xref="PDB:1KJ6"
                     /db_xref="UniProtKB/Swiss-Prot:P81534"
                     /protein_id="CAC03097.1"
                     /translation="MRIHYLLFALLFLFLVPVPGHGGIINTLQKYYCRVRGGRCAVLS
                     CLPKEEQIGKCSTRGRKCCRRKK"
     sig_peptide     33..98
                     /gene="BD-3"
     mat_peptide     99..233
                     /gene="BD-3"
                     /product="beta-defensin-3"
                     /experiment="experimental evidence, no additional details
                     recorded"
BASE COUNT          105 a           62 c           80 g           90 t
ORIGIN      
        1 tgagtctcag cgtggggtga agcctagcag ctatgaggat ccattatctt ctgtttgctt
       61 tgctcttcct gtttttggtg cctgtcccag gtcatggagg aatcataaac acattacaga
      121 aatattattg cagagtcaga ggcggccggt gtgctgtgct cagctgcctt ccaaaggagg
      181 aacagatcgg caagtgctcg acgcgtggcc gaaaatgctg ccgaagaaag aaataaaaac
      241 cctgaaacat gacgagagtg ttgtaaagtg tggaaatgcc ttcttaaagt ttataaaagt
      301 aaaatcaaat tacatttttt tttcaaaaaa aaaaaaa
//