LOCUS AJ011736 1303 bp mRNA linear HUM 07-OCT-2008 DEFINITION Homo sapiens mRNA for growth factor receptor binding protein (GRBLG). ACCESSION AJ011736 VERSION AJ011736.1 KEYWORDS grblg gene; growth factor receptor binding protein. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1303) AUTHORS Kedra D. JOURNAL Submitted (01-OCT-1998) to the INSDC. Kedra D., Dept. of Molecular Medicine, Karolinska Hospital, Center of Molecular Medicine (CMM), building L-8:00, S-17176 Stockholm, SWEDEN. REFERENCE 2 AUTHORS Kedra D., Dumanski J.P. TITLE Cloning of the human and mouse growth factor receptor binding protein like genes. JOURNAL Unpublished. FEATURES Location/Qualifiers source 1..1303 /db_xref="H-InvDB:HIT000244538" /organism="Homo sapiens" /chromosome="22" /map="q13" /mol_type="mRNA" /db_xref="taxon:9606" exon 1..194 /gene="grblg" /number=1 /experiment="experimental evidence, no additional details recorded" exon 195..286 /gene="grblg" /number=2 /experiment="experimental evidence, no additional details recorded" CDS 209..1201 /gene="grblg" /product="growth factor receptor binding protein (GRBLG)" /db_xref="GOA:O75791" /db_xref="H-InvDB:HIT000244538.13" /db_xref="HGNC:HGNC:4563" /db_xref="InterPro:IPR000980" /db_xref="InterPro:IPR001452" /db_xref="InterPro:IPR035646" /db_xref="InterPro:IPR036028" /db_xref="InterPro:IPR036860" /db_xref="PDB:5GJH" /db_xref="UniProtKB/Swiss-Prot:O75791" /protein_id="CAA09757.1" /translation="MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEG YVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDV QHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSL DRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPP QQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWA RALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR" exon 287..378 /gene="grblg" /number=3 /experiment="experimental evidence, no additional details recorded" exon 379..498 /gene="grblg" /number=4 /experiment="experimental evidence, no additional details recorded" exon 499..667 /gene="grblg" /number=5 /experiment="experimental evidence, no additional details recorded" exon 668..898 /gene="grblg" /number=6 /experiment="experimental evidence, no additional details recorded" exon 899..1021 /gene="grblg" /number=7 /experiment="experimental evidence, no additional details recorded" exon 1022..1303 /gene="grblg" /number=8 /experiment="experimental evidence, no additional details recorded" BASE COUNT 343 a 352 c 341 g 267 t ORIGIN 1 aggaggcaca gttaatggat ctgtaaactt gcaccctctt tcagagtggt acatggaaga 61 cagcacaaag tggatccata ctctgaaatg cagtaactct gatgcttgaa tttgttctcc 121 cttcttgcca gaaaggattc taataactcg gtgtcaaagc caagacataa actcaatctc 181 ttctcttcca aaagcttcac gttacagcat ggaagctgtt gccaagtttg atttcactgc 241 ttcaggtgag gatgaactga gctttcacac tggagatgtt ttgaagattt taagtaacca 301 agaggagtgg tttaaggcgg agcttgggag ccaggaagga tatgtgccca agaatttcat 361 agacatccag tttcccaaat ggtttcacga aggcctctct cgacaccagg cagagaactt 421 actcatgggc aaggaggttg gcttcttcat catccgggcc agccagagct ccccagggga 481 cttctccatc tctgtcaggc atgaggatga cgttcaacac ttcaaggtca tgcgagacaa 541 caagggtaat tactttctgt ggactgagaa gtttccatcc ctaaataagc tggtagacta 601 ctacaggaca aattccatct ccagacagaa gcagatcttc cttagagaca gaacccgaga 661 agaccagggt caccggggca acagcctgga ccggaggtcc cagggaggcc cacacctcag 721 tggggctgtg ggagaagaaa tccgaccttc gatgaaccgg aagctgtcgg atcacccccc 781 gacccttccc ctgcagcagc accagcacca gccacagcct ccgcaatatg ccccagcgcc 841 ccagcagctg cagcagcccc cacagcagcg atatctgcag caccaccatt tccaccagga 901 acgccgagga ggcagccttg acataaatga tgggcattgt ggcaccggct tgggcagtga 961 aatgaatgcg gccctcatgc atcggagaca cacagaccca gtgcagctcc aggcggcagg 1021 gcgagtgcgg tgggcccggg cgctgtatga ctttgaggcc ctggaggatg acgagctggg 1081 gttccacagc ggggaggtgg tggaggtcct ggatagctcc aacccatcct ggtggaccgg 1141 ccgcctgcac aacaagctgg gcctcttccc tgccaactac gtggcaccca tgacccgata 1201 aactcttcag gggacagaag ctttttgtct ggagctgccc acaagaaaga gggcaaggaa 1261 aaaaggctgg actccatgac tatatataca tacatctatc tac //