LOCUS       AJ010438                 630 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for vascular endothelial growth factor, splicing
            variant VEGF183.
ACCESSION   AJ010438
VERSION     AJ010438.1
KEYWORDS    vascular endothelial growth factor; vegf gene; VEGF183 protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 630)
  AUTHORS   Pei D.
  JOURNAL   Submitted (20-AUG-1998) to the INSDC. Pei D., Pharmacology,
            University of Minnesota, 3-249 Millard Hall, 435 Delaware St. S.E.,
            Minneapolis, MN55455, USA.
REFERENCE   2
  AUTHORS   Lei J., Jiang A., Pei D.
  TITLE     Identification and Characterization of a new splicing variant of
            vascular endothelial growth factor: VEGF183
  JOURNAL   Biochim. Biophys. Acta, Gene Struct. Expr. 1443, 400-406(1998).
FEATURES             Location/Qualifiers
     source          1..630
                     /db_xref="H-InvDB:HIT000244409"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /tissue_type="kidney"
                     /db_xref="taxon:9606"
     CDS             1..630
                     /gene="vegf"
                     /standard_name="vascular endothelial growth factor"
                     /product="VEGF183 protein"
                     /function="angiogenesis"
                     /db_xref="GOA:P15692"
                     /db_xref="H-InvDB:HIT000244409.13"
                     /db_xref="HGNC:HGNC:12680"
                     /db_xref="InterPro:IPR000072"
                     /db_xref="InterPro:IPR023581"
                     /db_xref="InterPro:IPR027928"
                     /db_xref="InterPro:IPR029034"
                     /db_xref="InterPro:IPR036841"
                     /db_xref="PDB:1BJ1"
                     /db_xref="PDB:1CZ8"
                     /db_xref="PDB:1FLT"
                     /db_xref="PDB:1KAT"
                     /db_xref="PDB:1KMX"
                     /db_xref="PDB:1MJV"
                     /db_xref="PDB:1MKG"
                     /db_xref="PDB:1MKK"
                     /db_xref="PDB:1QTY"
                     /db_xref="PDB:1TZH"
                     /db_xref="PDB:1TZI"
                     /db_xref="PDB:1VGH"
                     /db_xref="PDB:1VPF"
                     /db_xref="PDB:1VPP"
                     /db_xref="PDB:2FJG"
                     /db_xref="PDB:2FJH"
                     /db_xref="PDB:2QR0"
                     /db_xref="PDB:2VGH"
                     /db_xref="PDB:2VPF"
                     /db_xref="PDB:3BDY"
                     /db_xref="PDB:3P9W"
                     /db_xref="PDB:3QTK"
                     /db_xref="PDB:3S1B"
                     /db_xref="PDB:3S1K"
                     /db_xref="PDB:3V2A"
                     /db_xref="PDB:4DEQ"
                     /db_xref="PDB:4GLN"
                     /db_xref="PDB:4GLS"
                     /db_xref="PDB:4KZN"
                     /db_xref="PDB:4QAF"
                     /db_xref="PDB:4WPB"
                     /db_xref="PDB:4ZFF"
                     /db_xref="PDB:5DN2"
                     /db_xref="PDB:5FV1"
                     /db_xref="PDB:5FV2"
                     /db_xref="PDB:5HHC"
                     /db_xref="PDB:5HHD"
                     /db_xref="PDB:5O4E"
                     /db_xref="PDB:5T89"
                     /db_xref="PDB:6BFT"
                     /db_xref="PDB:6D3O"
                     /db_xref="UniProtKB/Swiss-Prot:P15692"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /protein_id="CAA09179.1"
                     /translation="MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFM
                     DVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNI
                     TMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRP
                     CGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR"
     sig_peptide     1..78
                     /gene="vegf"
     mat_peptide     79..627
                     /gene="vegf"
                     /product="VEGF183 protein"
BASE COUNT          182 a          152 c          174 g          122 t
ORIGIN      
        1 atgaactttc tgctgtcttg ggtgcattgg agccttgcct tgctgctcta cctccaccat
       61 gccaagtggt cccaggctgc acccatggca gaaggaggag ggcagaatca tcacgaagtg
      121 gtgaagttca tggatgtcta tcagcgcagc tactgccatc caatcgagac cctggtggac
      181 atcttccagg agtaccctga tgagatcgag tacatcttca agccatcctg tgtgcccctg
      241 atgcgatgcg ggggctgctg caatgacgag ggcctggagt gtgtgcccac tgaggagtcc
      301 aacatcacca tgcagattat gcggatcaaa cctcaccaag gccagcacat aggagagatg
      361 agcttcctac agcacaacaa atgtgaatgc agaccaaaga aagatagagc aagacaagaa
      421 aaaaaatcag ttcgaggaaa gggaaagggg caaaaacgaa agcgcaagaa atcccgtccc
      481 tgtgggcctt gctcagagcg gagaaagcat ttgtttgtac aagatccgca gacgtgtaaa
      541 tgttcctgca aaaacacaga ctcgcgttgc aaggcgaggc agcttgagtt aaacgaacgt
      601 acttgcagat gtgacaagcc gaggcggtga
//