LOCUS       AJ010148                 429 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for clathrin-associated protein AP17.
ACCESSION   AJ010148
VERSION     AJ010148.1
KEYWORDS    claps2 gene; clathrin-associated protein AP17.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 429)
  AUTHORS   Holzmann K.
  JOURNAL   Submitted (06-AUG-1998) to the INSDC. Holzmann K., Institute of
            Tumor Biology-Cancer Research, Borschkegasse 8a, Vienna, A-1090,
            AUSTRIA.
REFERENCE   2
  AUTHORS   Holzmann K., Poeltl A., Sauermann G.
  TITLE     A novel spliced transcript of human CLAPS2 encoding a protein
            alternative to clathrin adaptor protein AP17
  JOURNAL   Gene 220(1-2), 39-44(1998).
   PUBMED   9767099
FEATURES             Location/Qualifiers
     source          1..429
                     /db_xref="H-InvDB:HIT000244393"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone="B1"
                     /cell_type="leukocyte"
                     /db_xref="taxon:9606"
     CDS             1..429
                     /codon_start=1
                     /gene="claps2"
                     /product="clathrin-associated protein AP17"
                     /db_xref="GOA:P53680"
                     /db_xref="H-InvDB:HIT000244393.12"
                     /db_xref="HGNC:HGNC:565"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027156"
                     /db_xref="UniProtKB/Swiss-Prot:P53680"
                     /protein_id="CAA09018.1"
                     /translation="MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDA
                     KHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNKLAYLEGIHNFVEVLNEYFHNVCELD
                     LVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE"
BASE COUNT          109 a          105 c          114 g          101 t
ORIGIN      
        1 atgatccgct ttatcctcat ccagaaccgg gcaggcaaga cgcgcctggc caagtggtac
       61 atgcagtttg atgatgatga gaaacagaag ctgatcgagg aggtgcatgc cgtggtcacc
      121 gtccgagacg ccaaacacac caactttgtg gagttccgga actttaagat catttaccgc
      181 cgctatgctg gcctctactt ctgcatctgt gtggatgtca atgacaacaa actggcttac
      241 ctggagggca ttcacaactt cgtggaggtc ttaaacgaat atttccacaa tgtctgtgaa
      301 ctggacctgg tgttcaactt ctacaaggtt tacacggtcg tggacgagat gttcctggct
      361 ggcgaaatcc gagagaccag ccagacgaag gtgctgaaac agctgctgat gctacagtcc
      421 ctggagtga
//