LOCUS AJ010148 429 bp mRNA linear HUM 07-OCT-2008 DEFINITION Homo sapiens mRNA for clathrin-associated protein AP17. ACCESSION AJ010148 VERSION AJ010148.1 KEYWORDS claps2 gene; clathrin-associated protein AP17. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 429) AUTHORS Holzmann K. JOURNAL Submitted (06-AUG-1998) to the INSDC. Holzmann K., Institute of Tumor Biology-Cancer Research, Borschkegasse 8a, Vienna, A-1090, AUSTRIA. REFERENCE 2 AUTHORS Holzmann K., Poeltl A., Sauermann G. TITLE A novel spliced transcript of human CLAPS2 encoding a protein alternative to clathrin adaptor protein AP17 JOURNAL Gene 220(1-2), 39-44(1998). PUBMED 9767099 FEATURES Location/Qualifiers source 1..429 /db_xref="H-InvDB:HIT000244393" /organism="Homo sapiens" /mol_type="mRNA" /clone="B1" /cell_type="leukocyte" /db_xref="taxon:9606" CDS 1..429 /codon_start=1 /gene="claps2" /product="clathrin-associated protein AP17" /db_xref="GOA:P53680" /db_xref="H-InvDB:HIT000244393.12" /db_xref="HGNC:HGNC:565" /db_xref="InterPro:IPR000804" /db_xref="InterPro:IPR011012" /db_xref="InterPro:IPR016635" /db_xref="InterPro:IPR022775" /db_xref="InterPro:IPR027156" /db_xref="UniProtKB/Swiss-Prot:P53680" /protein_id="CAA09018.1" /translation="MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDA KHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNKLAYLEGIHNFVEVLNEYFHNVCELD LVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE" BASE COUNT 109 a 105 c 114 g 101 t ORIGIN 1 atgatccgct ttatcctcat ccagaaccgg gcaggcaaga cgcgcctggc caagtggtac 61 atgcagtttg atgatgatga gaaacagaag ctgatcgagg aggtgcatgc cgtggtcacc 121 gtccgagacg ccaaacacac caactttgtg gagttccgga actttaagat catttaccgc 181 cgctatgctg gcctctactt ctgcatctgt gtggatgtca atgacaacaa actggcttac 241 ctggagggca ttcacaactt cgtggaggtc ttaaacgaat atttccacaa tgtctgtgaa 301 ctggacctgg tgttcaactt ctacaaggtt tacacggtcg tggacgagat gttcctggct 361 ggcgaaatcc gagagaccag ccagacgaag gtgctgaaac agctgctgat gctacagtcc 421 ctggagtga //