LOCUS AJ010098 350 bp mRNA linear HUM 07-OCT-2008 DEFINITION Homo sapiens mRNA for killer activating receptor associated protein, isoform b. ACCESSION AJ010098 VERSION AJ010098.1 KEYWORDS isoform b; KARAP-b gene; killer activating receptor associated protein; natural killer cell. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 350) AUTHORS Biassoni R. JOURNAL Submitted (04-AUG-1998) to the INSDC. Biassoni R., Molecular Immunology Unit, IST/CBA, Largo R. Benzi 10, 16132, ITALY. REFERENCE 2 AUTHORS Cantoni C., Biassoni R. TITLE Killer Activating Receptor Associated Protein isoform b JOURNAL Unpublished. FEATURES Location/Qualifiers source 1..350 /db_xref="H-InvDB:HIT000244383" /organism="Homo sapiens" /mol_type="mRNA" /cell_type="Natural killer (NK)" /tissue_type="lymphoid" /db_xref="taxon:9606" CDS 3..341 /gene="KARAP-b" /product="killer activating receptor associated protein, isoform b" /db_xref="GOA:O43914" /db_xref="H-InvDB:HIT000244383.11" /db_xref="HGNC:HGNC:12449" /db_xref="InterPro:IPR026200" /db_xref="PDB:2L34" /db_xref="PDB:2L35" /db_xref="PDB:4WO1" /db_xref="PDB:4WOL" /db_xref="UniProtKB/Swiss-Prot:O43914" /protein_id="CAB52288.1" /translation="MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLA GIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEATRKQRITETESPYQELQGQRSDVYS DLNTQRPYYK" BASE COUNT 61 a 104 c 116 g 69 t ORIGIN 1 tcatgggggg acttgaaccc tgcagcaggc tcctgctcct gcctctcctg ctggctgtaa 61 gtggtctccg tcctgtccag gcccaggccc agagcgattg cagttgctct acggtgagcc 121 cgggcgtgct ggcagggatc gtgatgggag acctggtgct gacagtgctc attgccctgg 181 ccgtgtactt cctgggccgg ctggtccctc gggggcgagg ggctgcggag gcgacccgga 241 aacagcgtat cactgagacc gagtcgcctt atcaggagct ccagggtcag aggtcggatg 301 tctacagcga cctcaacaca cagaggccgt attacaaatg agcccgaatc //