LOCUS       AJ010098                 350 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for killer activating receptor associated
            protein, isoform b.
ACCESSION   AJ010098
VERSION     AJ010098.1
KEYWORDS    isoform b; KARAP-b gene; killer activating receptor associated
            protein; natural killer cell.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 350)
  AUTHORS   Biassoni R.
  JOURNAL   Submitted (04-AUG-1998) to the INSDC. Biassoni R., Molecular
            Immunology Unit, IST/CBA, Largo R. Benzi 10, 16132, ITALY.
REFERENCE   2
  AUTHORS   Cantoni C., Biassoni R.
  TITLE     Killer Activating Receptor Associated Protein isoform b
  JOURNAL   Unpublished.
FEATURES             Location/Qualifiers
     source          1..350
                     /db_xref="H-InvDB:HIT000244383"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_type="Natural killer (NK)"
                     /tissue_type="lymphoid"
                     /db_xref="taxon:9606"
     CDS             3..341
                     /gene="KARAP-b"
                     /product="killer activating receptor associated protein,
                     isoform b"
                     /db_xref="GOA:O43914"
                     /db_xref="H-InvDB:HIT000244383.11"
                     /db_xref="HGNC:HGNC:12449"
                     /db_xref="InterPro:IPR026200"
                     /db_xref="PDB:2L34"
                     /db_xref="PDB:2L35"
                     /db_xref="PDB:4WO1"
                     /db_xref="PDB:4WOL"
                     /db_xref="UniProtKB/Swiss-Prot:O43914"
                     /protein_id="CAB52288.1"
                     /translation="MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLA
                     GIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEATRKQRITETESPYQELQGQRSDVYS
                     DLNTQRPYYK"
BASE COUNT           61 a          104 c          116 g           69 t
ORIGIN      
        1 tcatgggggg acttgaaccc tgcagcaggc tcctgctcct gcctctcctg ctggctgtaa
       61 gtggtctccg tcctgtccag gcccaggccc agagcgattg cagttgctct acggtgagcc
      121 cgggcgtgct ggcagggatc gtgatgggag acctggtgct gacagtgctc attgccctgg
      181 ccgtgtactt cctgggccgg ctggtccctc gggggcgagg ggctgcggag gcgacccgga
      241 aacagcgtat cactgagacc gagtcgcctt atcaggagct ccagggtcag aggtcggatg
      301 tctacagcga cctcaacaca cagaggccgt attacaaatg agcccgaatc
//