LOCUS AJ001481 1227 bp mRNA linear HUM 21-OCT-2008
DEFINITION Homo sapiens mRNA for DUX1 protein.
ACCESSION AJ001481
VERSION AJ001481.1
KEYWORDS DUX1 protein.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1
AUTHORS Belayew A.
JOURNAL Submitted (11-SEP-1997) to the INSDC. Belayew A., Center for
Molecular and Vascular Biology, University of Leuven, Herestraat,
49, B-3000-Leuven, BELGIUM.
REMARK revised by [3]
REFERENCE 3 (bases 1 to 1227)
AUTHORS Belayew A.
JOURNAL Submitted (29-MAY-1998) to the INSDC. Belayew A., Center for
Molecular and Vascular Biology, University of Leuven, Herestraat,
49, B-3000-Leuven, BELGIUM.
REFERENCE 4
AUTHORS Ding H., Beckers M.C., Plaisance S., Marynen P., Collen D.,
Belayew A.
TITLE Characterization of a double homeodomain protein (DUX1) encoded by
a cDNA homologous to 3.3 kb dispersed repeated elements
JOURNAL Hum. Mol. Genet. 7(11), 1681-1694(1998).
PUBMED 9736770
FEATURES Location/Qualifiers
source 1..1227
/organism="Homo sapiens"
/mol_type="mRNA"
/cell_line="TE671"
/cell_type="rhabdomyosarcoma"
/db_xref="taxon:9606"
CDS 113..625
/gene="DUX1"
/function="transcription factor"
/note="protein with two Pax-type homeodomains"
/db_xref="GOA:O43812"
/db_xref="H-InvDB:HIT000243877.13"
/db_xref="HGNC:HGNC:3079"
/db_xref="InterPro:IPR000047"
/db_xref="InterPro:IPR001356"
/db_xref="InterPro:IPR009057"
/db_xref="InterPro:IPR017970"
/db_xref="UniProtKB/Swiss-Prot:O43812"
/protein_id="CAA04776.1"
/translation="MALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRACFERNLYP
GIATKEELAQGIDIPEPRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQKGRRKRTAIT
GSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHRGQSGRAPTQA
SIRCNAAPIG"
misc_feature 167..346
/note="homeobox"
misc_feature 392..571
/note="homeobox"
BASE COUNT 239 a 412 c 381 g 195 t
ORIGIN
1 caggcctcct ggcagcacct gcgcagtgaa caggctggct gaggtgcacg ggagcccgcc
61 cgcctctctc tgcccgtgtc agtccgtgaa attccggccg gggctccctg agatggccct
121 cctgacagct ttggacgaca ccctccccga ggaagcccag ggaccgggaa ggcgaatgat
181 actcctttcg accccgagtc aaagtgatgc cctgcgagcc tgctttgagc ggaacctgta
241 cccgggcatt gccaccaaag aagagctggc ccagggcatc gacattccgg agcccagggt
301 ccagatttgg tttcagaatg agagatcatg ccagttgagg cagcaccggc ggcaatctcg
361 gccctggccc gggagacgtg acccgcaaaa aggcagacga aagcggactg ccatcaccgg
421 atcccaaacc gccctgctcc tccgagcctt tgagaaggat cgctttccag gcattgctgc
481 cagggaagag ctggccagag agacgggcct cccggagtcc aggattcaga tctggtttca
541 gaatcgaaga gccaggcacc ggggacagtc tggcagggcg cccacgcagg caagcatccg
601 gtgcaatgca gccccaattg ggtgacaccc tgctctctcg tgggtcgcct ttgcccacac
661 tggcgcatgg ggaaaggggc ttcctgcacc acacatgctc tcccacagtg ggctttcgtg
721 agccatggat tgagggccgt ccctgtgctc ctgcccagcc aggccgcgca ggcagaaggg
781 atctcccaac ctgccccagc acatggggat tttgcctaca ccgcccaggc tcctccagaa
841 ggggcgctct cccacactca cactcctagg tggcatccac acaagggcaa aatccggaag
901 gactgggacg cgcagcgcga cggccttccg ggcacttgcg cggtgggaca gcctgggccc
961 tctcaagcgg ggccacaggg ccaaggtgtg cttgcgccac ccgcgtccca gggaagtccg
1021 tggtgggggt ggagcagggg tacccaggtc gccggtgtgg cgtggaacct caagcagggg
1081 caattccacc tcaccagccc acgcccccag aggcctccac acggcagggg cagatgcaag
1141 gcatctcagc accctcccag gcgctcctgg agccagggtg ctcgtctgca ctccactcca
1201 tcctgctgct ggatgagctc ctggcga
//