LOCUS       AF503918                 258 bp    mRNA    linear   HUM 22-MAY-2002
DEFINITION  Homo sapiens CDC26 subunit of anaphase promoting complex (CDC26)
            mRNA, complete cds.
ACCESSION   AF503918
VERSION     AF503918.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 258)
  AUTHORS   Gmachl,M., Gieffers,C., Podtelejnikov,A.V., Mann,M. and Peters,J.M.
  TITLE     The RING-H2 finger protein APC11 and the E2 enzyme UBC4 are
            sufficient to ubiquitinate substrates of the anaphase-promoting
            complex
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 97 (16), 8973-8978 (2000)
   PUBMED   10922056
REFERENCE   2  (bases 1 to 258)
  AUTHORS   Gmachl,M., Gieffers,C., Podtelejnikov,A.V., Mann,M. and
            Peters,J.-M.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-APR-2002) Institute of Molecular Pathology (IMP), Dr.
            Bohrgasse, Vienna 1030, Austria
FEATURES             Location/Qualifiers
     source          1..258
                     /db_xref="H-InvDB:HIT000080970_04"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..258
                     /gene="CDC26"
     CDS             1..258
                     /gene="CDC26"
                     /note="cell cycle protein; ubiquitin; proteolysis"
                     /codon_start=1
                     /product="CDC26 subunit of anaphase promoting complex"
                     /protein_id="AAM34207.1"
                     /translation="MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDG
                     EGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF"
BASE COUNT           88 a           47 c           69 g           54 t
ORIGIN      
        1 atgctgagac ggaaaccaac acgcctagag ctaaagcttg atgacattga agagtttgag
       61 aacattcgaa aggacctgga gacccgtaag aaacagaagg aagatgtgga agttgtagga
      121 ggcagtgatg gagaaggagc cattgggctt agcagtgatc ccaagagccg ggaacaaatg
      181 atcaatgatc ggattggtta taaaccccaa cccaagccca ataatcgttc atctcaattt
      241 ggaagtcttg aattttag
//