LOCUS AF503918 258 bp mRNA linear HUM 22-MAY-2002 DEFINITION Homo sapiens CDC26 subunit of anaphase promoting complex (CDC26) mRNA, complete cds. ACCESSION AF503918 VERSION AF503918.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 258) AUTHORS Gmachl,M., Gieffers,C., Podtelejnikov,A.V., Mann,M. and Peters,J.M. TITLE The RING-H2 finger protein APC11 and the E2 enzyme UBC4 are sufficient to ubiquitinate substrates of the anaphase-promoting complex JOURNAL Proc. Natl. Acad. Sci. U.S.A. 97 (16), 8973-8978 (2000) PUBMED 10922056 REFERENCE 2 (bases 1 to 258) AUTHORS Gmachl,M., Gieffers,C., Podtelejnikov,A.V., Mann,M. and Peters,J.-M. TITLE Direct Submission JOURNAL Submitted (18-APR-2002) Institute of Molecular Pathology (IMP), Dr. Bohrgasse, Vienna 1030, Austria FEATURES Location/Qualifiers source 1..258 /db_xref="H-InvDB:HIT000080970_04" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" gene 1..258 /gene="CDC26" CDS 1..258 /gene="CDC26" /note="cell cycle protein; ubiquitin; proteolysis" /codon_start=1 /product="CDC26 subunit of anaphase promoting complex" /protein_id="AAM34207.1" /translation="MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDG EGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF" BASE COUNT 88 a 47 c 69 g 54 t ORIGIN 1 atgctgagac ggaaaccaac acgcctagag ctaaagcttg atgacattga agagtttgag 61 aacattcgaa aggacctgga gacccgtaag aaacagaagg aagatgtgga agttgtagga 121 ggcagtgatg gagaaggagc cattgggctt agcagtgatc ccaagagccg ggaacaaatg 181 atcaatgatc ggattggtta taaaccccaa cccaagccca ataatcgttc atctcaattt 241 ggaagtcttg aattttag //