LOCUS       AF490937                 363 bp    mRNA    linear   HUM 24-JUL-2016
DEFINITION  Homo sapiens isolate ST-MAR-K4 immunoglobulin kappa light chain
            variable region mRNA, partial cds.
ACCESSION   AF490937
VERSION     AF490937.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 363)
  AUTHORS   Abraham,R.S., Geyer,S.M., Price-Troska,T.L., Allmer,C., Kyle,R.A.,
            Gertz,M.A. and Fonseca,R.
  TITLE     Immunoglobulin light chain variable (V) region genes influence
            clinical presentation and outcome in light chain-associated
            amyloidosis (AL)
  JOURNAL   Blood 101 (10), 3801-3808 (2003)
   PUBMED   12515719
REFERENCE   2  (bases 1 to 363)
  AUTHORS   Abraham,R.S., Price-Troska,T.L. and Fonseca,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-MAR-2002) Clinical Biochemistry and Immunology, Mayo
            Clinic, 200 1 St. SW, Rochester, MN 55905, USA
REFERENCE   3  (bases 1 to 363)
  AUTHORS   Abraham,R.S., Poshusta,T.L. and Ramirez-Alvarado,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-SEP-2008) Clinical Biochemistry and Immunology, Mayo
            Clinic, 200 1 St. SW, Rochester, MN 55905, USA
  REMARK    Sequence update by submitter
COMMENT     On Sep 22, 2008 this sequence version replaced AF490937.1.
FEATURES             Location/Qualifiers
     source          1..363
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="ST-MAR-K4"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /tissue_type="bone marrow"
                     /note="from patient with primary amyloidosis"
     CDS             <1..>363
                     /note="VK4 family"
                     /codon_start=1
                     /product="immunoglobulin kappa light chain variable
                     region"
                     /protein_id="AAO11866.2"
                     /translation="WISGAYGDIVMTQSPDSLAMSLGGRATISCKSSHSILYSSNNKN
                     YLAWYQQKPGQPPNLLIYWASTRESGVPDRFSGSGSGTDFTLTISNLQAEDAAVYYCQ
                     QYYSGPPYTFGQGTKLEIK"
BASE COUNT           85 a          101 c           92 g           85 t
ORIGIN      
        1 tggatctctg gtgcctacgg ggacatcgtg atgacccagt ctccagactc cctggctatg
       61 tctctgggcg ggagggccac catcagctgc aagtccagcc acagtatttt atacagctcc
      121 aacaataaga actacttagc ttggtaccag cagaaaccag gacagcctcc taacttgctc
      181 atttactggg cttctacccg ggaatccggg gtccctgacc gattcagtgg cagcgggtct
      241 gggacagatt tcactctcac catcagcaac ctgcaggctg aagatgcggc ggtttattac
      301 tgtcagcaat attatagtgg tcctccgtac acttttggcc aggggaccaa gctggagatc
      361 aaa
//