LOCUS AF490937 363 bp mRNA linear HUM 24-JUL-2016 DEFINITION Homo sapiens isolate ST-MAR-K4 immunoglobulin kappa light chain variable region mRNA, partial cds. ACCESSION AF490937 VERSION AF490937.2 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 363) AUTHORS Abraham,R.S., Geyer,S.M., Price-Troska,T.L., Allmer,C., Kyle,R.A., Gertz,M.A. and Fonseca,R. TITLE Immunoglobulin light chain variable (V) region genes influence clinical presentation and outcome in light chain-associated amyloidosis (AL) JOURNAL Blood 101 (10), 3801-3808 (2003) PUBMED 12515719 REFERENCE 2 (bases 1 to 363) AUTHORS Abraham,R.S., Price-Troska,T.L. and Fonseca,R. TITLE Direct Submission JOURNAL Submitted (08-MAR-2002) Clinical Biochemistry and Immunology, Mayo Clinic, 200 1 St. SW, Rochester, MN 55905, USA REFERENCE 3 (bases 1 to 363) AUTHORS Abraham,R.S., Poshusta,T.L. and Ramirez-Alvarado,M. TITLE Direct Submission JOURNAL Submitted (22-SEP-2008) Clinical Biochemistry and Immunology, Mayo Clinic, 200 1 St. SW, Rochester, MN 55905, USA REMARK Sequence update by submitter COMMENT On Sep 22, 2008 this sequence version replaced AF490937.1. FEATURES Location/Qualifiers source 1..363 /organism="Homo sapiens" /mol_type="mRNA" /isolate="ST-MAR-K4" /db_xref="taxon:9606" /chromosome="2" /tissue_type="bone marrow" /note="from patient with primary amyloidosis" CDS <1..>363 /note="VK4 family" /codon_start=1 /product="immunoglobulin kappa light chain variable region" /protein_id="AAO11866.2" /translation="WISGAYGDIVMTQSPDSLAMSLGGRATISCKSSHSILYSSNNKN YLAWYQQKPGQPPNLLIYWASTRESGVPDRFSGSGSGTDFTLTISNLQAEDAAVYYCQ QYYSGPPYTFGQGTKLEIK" BASE COUNT 85 a 101 c 92 g 85 t ORIGIN 1 tggatctctg gtgcctacgg ggacatcgtg atgacccagt ctccagactc cctggctatg 61 tctctgggcg ggagggccac catcagctgc aagtccagcc acagtatttt atacagctcc 121 aacaataaga actacttagc ttggtaccag cagaaaccag gacagcctcc taacttgctc 181 atttactggg cttctacccg ggaatccggg gtccctgacc gattcagtgg cagcgggtct 241 gggacagatt tcactctcac catcagcaac ctgcaggctg aagatgcggc ggtttattac 301 tgtcagcaat attatagtgg tcctccgtac acttttggcc aggggaccaa gctggagatc 361 aaa //