LOCUS       AF486833                 161 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens huntingtin-interacting protein 1 (HIP1) mRNA, exon 1
            and partial cds.
ACCESSION   AF486833
VERSION     AF486833.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 161)
  AUTHORS   Rao,D.S., Chang,J.C., Kumar,P.D., Mizukami,I., Smithson,G.M.,
            Bradley,S.V., Parlow,A.F. and Ross,T.S.
  TITLE     Huntingtin interacting protein 1 Is a clathrin coat binding protein
            required for differentiation of late spermatogenic progenitors
  JOURNAL   Mol. Cell. Biol. 21 (22), 7796-7806 (2001)
   PUBMED   11604514
REFERENCE   2  (bases 1 to 161)
  AUTHORS   Rao,D.S., Kumar,P.D., Mizukami,I., Chang,J.C., Smithson,G.M.,
            Bradley,S.V., Parlow,A.F. and Ross,T.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-FEB-2002) Internal Medicine, University of Michigan,
            1500 E. Medical Center Dr., Ann Arbor, MI 48109-0942, USA
FEATURES             Location/Qualifiers
     source          1..161
                     /db_xref="H-InvDB:HIT000080555"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="7"
                     /map="7q11.2"
     gene            1..>161
                     /gene="HIP1"
     exon            1..161
                     /gene="HIP1"
                     /number=1
     CDS             42..>161
                     /gene="HIP1"
                     /codon_start=1
                     /product="huntingtin-interacting protein 1"
                     /protein_id="AAL93198.1"
                     /translation="MDRMASSMKQVPNPLPKVLSRRGVGAGLEAAERESFERTQ"
BASE COUNT           25 a           52 c           65 g           19 t
ORIGIN      
        1 cggggcagcc gagggcccct gactcggctc ctcgcggcga catggatcgg atggccagct
       61 ccatgaagca ggtgcccaac ccactgccca aggtgctgag ccggcgcggg gtcggcgctg
      121 ggctggaggc ggcggagcgc gagagcttcg agcggactca g
//