LOCUS AF486833 161 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens huntingtin-interacting protein 1 (HIP1) mRNA, exon 1 and partial cds. ACCESSION AF486833 VERSION AF486833.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 161) AUTHORS Rao,D.S., Chang,J.C., Kumar,P.D., Mizukami,I., Smithson,G.M., Bradley,S.V., Parlow,A.F. and Ross,T.S. TITLE Huntingtin interacting protein 1 Is a clathrin coat binding protein required for differentiation of late spermatogenic progenitors JOURNAL Mol. Cell. Biol. 21 (22), 7796-7806 (2001) PUBMED 11604514 REFERENCE 2 (bases 1 to 161) AUTHORS Rao,D.S., Kumar,P.D., Mizukami,I., Chang,J.C., Smithson,G.M., Bradley,S.V., Parlow,A.F. and Ross,T.S. TITLE Direct Submission JOURNAL Submitted (22-FEB-2002) Internal Medicine, University of Michigan, 1500 E. Medical Center Dr., Ann Arbor, MI 48109-0942, USA FEATURES Location/Qualifiers source 1..161 /db_xref="H-InvDB:HIT000080555" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="7" /map="7q11.2" gene 1..>161 /gene="HIP1" exon 1..161 /gene="HIP1" /number=1 CDS 42..>161 /gene="HIP1" /codon_start=1 /product="huntingtin-interacting protein 1" /protein_id="AAL93198.1" /translation="MDRMASSMKQVPNPLPKVLSRRGVGAGLEAAERESFERTQ" BASE COUNT 25 a 52 c 65 g 19 t ORIGIN 1 cggggcagcc gagggcccct gactcggctc ctcgcggcga catggatcgg atggccagct 61 ccatgaagca ggtgcccaac ccactgccca aggtgctgag ccggcgcggg gtcggcgctg 121 ggctggaggc ggcggagcgc gagagcttcg agcggactca g //