LOCUS       AF466289                 225 bp    mRNA    linear   HUM 24-JUL-2016
DEFINITION  Homo sapiens tissue-type whole lung a disintegrin and
            metalloprotease domain 33 (ADAM33) mRNA, 5' UTR and partial cds.
ACCESSION   AF466289
VERSION     AF466289.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 225)
  AUTHORS   Van Eerdewegh,P., Little,R.D., Dupuis,J., Del Mastro,R.G.,
            Falls,K., Simon,J., Torrey,D., Pandit,S., McKenny,J.,
            Braunschweiger,K., Walsh,A., Liu,Z., Hayward,B., Folz,C.,
            Manning,S.P., Bawa,A., Saracino,L., Thackston,M., Benchekroun,Y.,
            Capparell,N., Wang,M., Adair,R., Feng,Y., Dubois,J.,
            FitzGerald,M.G., Huang,H., Gibson,R., Allen,K.M., Pedan,A.,
            Danzig,M.R., Umland,S.P., Egan,R.W., Cuss,F.M., Rorke,S.,
            Clough,J.B., Holloway,J.W., Holgate,S.T. and Keith,T.P.
  TITLE     Association of the ADAM33 gene with asthma and bronchial
            hyperresponsiveness
  JOURNAL   Nature 418 (6896), 426-430 (2002)
   PUBMED   12110844
REFERENCE   2  (bases 1 to 225)
  AUTHORS   Walsh,A., Del Mastro,R.G., Little,R.D. and Keith,T.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JAN-2002) Human Genetics, Genome Therapeutics
            Corporation, 100 Beaver Street, Waltham, MA 025453, USA
FEATURES             Location/Qualifiers
     source          1..225
                     /db_xref="H-InvDB:HIT000080329"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="20"
                     /map="20p13"
                     /tissue_type="whole lung"
     gene            1..>225
                     /gene="ADAM33"
     5'UTR           1..80
                     /gene="ADAM33"
     CDS             81..>225
                     /gene="ADAM33"
                     /codon_start=1
                     /product="a disintegrin and metalloprotease domain 33"
                     /protein_id="AAM80484.1"
                     /translation="MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHW
                     VLDG"
BASE COUNT           33 a           73 c           83 g           36 t
ORIGIN      
        1 cgggcacggg tcggccgcaa tccagcctgg gcggagccgg agttgcgagc cgctgcctag
       61 aggccgagga gctcacagct atgggctgga ggccccggag agctcggggg accccgttgc
      121 tgctgctgct actactgctg ctgctctggc cagtgccagg cgccggggtg cttcaaggac
      181 atatccctgg gcagccagtc accccgcact gggtcctgga tggac
//