LOCUS AF466289 225 bp mRNA linear HUM 24-JUL-2016 DEFINITION Homo sapiens tissue-type whole lung a disintegrin and metalloprotease domain 33 (ADAM33) mRNA, 5' UTR and partial cds. ACCESSION AF466289 VERSION AF466289.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 225) AUTHORS Van Eerdewegh,P., Little,R.D., Dupuis,J., Del Mastro,R.G., Falls,K., Simon,J., Torrey,D., Pandit,S., McKenny,J., Braunschweiger,K., Walsh,A., Liu,Z., Hayward,B., Folz,C., Manning,S.P., Bawa,A., Saracino,L., Thackston,M., Benchekroun,Y., Capparell,N., Wang,M., Adair,R., Feng,Y., Dubois,J., FitzGerald,M.G., Huang,H., Gibson,R., Allen,K.M., Pedan,A., Danzig,M.R., Umland,S.P., Egan,R.W., Cuss,F.M., Rorke,S., Clough,J.B., Holloway,J.W., Holgate,S.T. and Keith,T.P. TITLE Association of the ADAM33 gene with asthma and bronchial hyperresponsiveness JOURNAL Nature 418 (6896), 426-430 (2002) PUBMED 12110844 REFERENCE 2 (bases 1 to 225) AUTHORS Walsh,A., Del Mastro,R.G., Little,R.D. and Keith,T.P. TITLE Direct Submission JOURNAL Submitted (08-JAN-2002) Human Genetics, Genome Therapeutics Corporation, 100 Beaver Street, Waltham, MA 025453, USA FEATURES Location/Qualifiers source 1..225 /db_xref="H-InvDB:HIT000080329" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="20" /map="20p13" /tissue_type="whole lung" gene 1..>225 /gene="ADAM33" 5'UTR 1..80 /gene="ADAM33" CDS 81..>225 /gene="ADAM33" /codon_start=1 /product="a disintegrin and metalloprotease domain 33" /protein_id="AAM80484.1" /translation="MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHW VLDG" BASE COUNT 33 a 73 c 83 g 36 t ORIGIN 1 cgggcacggg tcggccgcaa tccagcctgg gcggagccgg agttgcgagc cgctgcctag 61 aggccgagga gctcacagct atgggctgga ggccccggag agctcggggg accccgttgc 121 tgctgctgct actactgctg ctgctctggc cagtgccagg cgccggggtg cttcaaggac 181 atatccctgg gcagccagtc accccgcact gggtcctgga tggac //