LOCUS       AF403479                 420 bp    mRNA    linear   HUM 04-NOV-2001
DEFINITION  Homo sapiens EWS/FLI1 activated transcript 2 protein mRNA, complete
            cds.
ACCESSION   AF403479
VERSION     AF403479.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 420)
  AUTHORS   Bouchon,A., Cella,M., Grierson,H.L., Cohen,J.I. and Colonna,M.
  TITLE     Cutting edge: activation of NK cell-mediated cytotoxicity by a
            SAP-independent receptor of the CD2 family
  JOURNAL   J. Immunol. (2001) In press
REFERENCE   2  (bases 1 to 420)
  AUTHORS   Colonna,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUL-2001) Basel Institute for Immunology, 487
            Grenzacherstrasse, Basel CH-4005, Switzerland
FEATURES             Location/Qualifiers
     source          1..420
                     /db_xref="H-InvDB:HIT000079153"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /tissue_type="leukocytes"
     CDS             1..399
                     /note="EAT-2; similar to SLAM-associated protein (SAP);
                     SH-2 domain-containing protein"
                     /codon_start=1
                     /product="EWS/FLI1 activated transcript 2 protein"
                     /protein_id="AAL27357.1"
                     /translation="MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCV
                     SFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIK
                     RTSPSLRWRGLKLELETFVNSNSDYVDVLP"
BASE COUNT          132 a           84 c          103 g          101 t
ORIGIN      
        1 atggatctgc cttactacca tggacgtctg accaagcaag actgtgagac cttgctgctc
       61 aaggaagggg tggatggcaa ctttctttta agagacagcg agtcgatacc aggagtcctg
      121 tgcctctgtg tctcgtttaa aaatattgtc tacacatacc gaatcttcag agagaaacac
      181 gggtattaca ggatacagac tgcagaaggt tctccaaaac aggtctttcc aagcctaaag
      241 gaactgatct ccaaatttga aaaaccaaat caggggatgg tggttcacct tttaaagcca
      301 ataaagagaa ccagccccag cttgagatgg agaggattga aattagagtt ggaaacattt
      361 gtgaacagta acagcgatta tgtggatgtc ttgccttgaa gataaggctg ccggacaaag
//