LOCUS AF403479 420 bp mRNA linear HUM 04-NOV-2001 DEFINITION Homo sapiens EWS/FLI1 activated transcript 2 protein mRNA, complete cds. ACCESSION AF403479 VERSION AF403479.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 420) AUTHORS Bouchon,A., Cella,M., Grierson,H.L., Cohen,J.I. and Colonna,M. TITLE Cutting edge: activation of NK cell-mediated cytotoxicity by a SAP-independent receptor of the CD2 family JOURNAL J. Immunol. (2001) In press REFERENCE 2 (bases 1 to 420) AUTHORS Colonna,M. TITLE Direct Submission JOURNAL Submitted (26-JUL-2001) Basel Institute for Immunology, 487 Grenzacherstrasse, Basel CH-4005, Switzerland FEATURES Location/Qualifiers source 1..420 /db_xref="H-InvDB:HIT000079153" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /tissue_type="leukocytes" CDS 1..399 /note="EAT-2; similar to SLAM-associated protein (SAP); SH-2 domain-containing protein" /codon_start=1 /product="EWS/FLI1 activated transcript 2 protein" /protein_id="AAL27357.1" /translation="MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCV SFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIK RTSPSLRWRGLKLELETFVNSNSDYVDVLP" BASE COUNT 132 a 84 c 103 g 101 t ORIGIN 1 atggatctgc cttactacca tggacgtctg accaagcaag actgtgagac cttgctgctc 61 aaggaagggg tggatggcaa ctttctttta agagacagcg agtcgatacc aggagtcctg 121 tgcctctgtg tctcgtttaa aaatattgtc tacacatacc gaatcttcag agagaaacac 181 gggtattaca ggatacagac tgcagaaggt tctccaaaac aggtctttcc aagcctaaag 241 gaactgatct ccaaatttga aaaaccaaat caggggatgg tggttcacct tttaaagcca 301 ataaagagaa ccagccccag cttgagatgg agaggattga aattagagtt ggaaacattt 361 gtgaacagta acagcgatta tgtggatgtc ttgccttgaa gataaggctg ccggacaaag //