LOCUS       AF397013                 353 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens C7orf10 protein mRNA, partial cds.
ACCESSION   AF397013
VERSION     AF397013.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 353)
  AUTHORS   Nakabayashi,K., Fernandez,B.A., Teshima,I., Shuman,C., Proud,V.K.,
            Curry,C.J., Chitayat,D., Grebe,T., Ming,J., Oshimura,M., Meguro,M.,
            Mitsuya,K., Deb-Rinker,P., Herbrick,J.A., Weksberg,R. and
            Scherer,S.W.
  TITLE     Molecular genetic studies of human chromosome 7 in Russell-Silver
            syndrome
  JOURNAL   Genomics 79 (2), 186-196 (2002)
   PUBMED   11829489
REFERENCE   2  (bases 1 to 353)
  AUTHORS   Nakabayashi,K., Fernandez,B.A., Teshima,I., Shuman,C.,
            Curry,C.J.R., Chitayat,D., Grebe,T., Ming,J., Oshimura,M.,
            Meguro,M., Mitsuya,K., Deb-Rinker,P., Herbrick,J.-A., Weksberg,R.
            and Scherer,S.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUL-2001) Genetics, Hospital for Sick Children, 555
            University Avenue, Toronto, ON M5G 1X8, Canada
FEATURES             Location/Qualifiers
     source          1..353
                     /db_xref="H-InvDB:HIT000078968"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="7"
                     /map="7p14"
     CDS             119..>353
                     /codon_start=1
                     /product="C7orf10 protein"
                     /protein_id="AAL76418.1"
                     /translation="MPSETHAMLATLARVAALRRTCLFSGRGGGRGLWTGRPQSDMNN
                     IKPLEGVKILDLTRVLAGPFATMNLGDLGAEVIK"
BASE COUNT           67 a           98 c          127 g           61 t
ORIGIN      
        1 cccagcaggc gactagtgct cagccccgcc cggcgggggc ggggtctgcg gcgtccgtgg
       61 gcgcccccca gtggcggcgg gtggcgccgc acggagttcg ccgcttgcac cgggaccgat
      121 gccatctgag acgcacgcga tgctggcgac gctggcgagg gtggcagctc tgcgcagaac
      181 ctgcctcttc tccggccggg gcggcgggag ggggctgtgg actggccgcc cgcagtcaga
      241 tatgaacaat ataaagccat tggaaggggt aaaaattctg gatctaacaa gagtcctggc
      301 gggacctttt gctactatga atttaggaga tcttggagca gaagttataa aag
//