LOCUS AF397013 353 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens C7orf10 protein mRNA, partial cds. ACCESSION AF397013 VERSION AF397013.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 353) AUTHORS Nakabayashi,K., Fernandez,B.A., Teshima,I., Shuman,C., Proud,V.K., Curry,C.J., Chitayat,D., Grebe,T., Ming,J., Oshimura,M., Meguro,M., Mitsuya,K., Deb-Rinker,P., Herbrick,J.A., Weksberg,R. and Scherer,S.W. TITLE Molecular genetic studies of human chromosome 7 in Russell-Silver syndrome JOURNAL Genomics 79 (2), 186-196 (2002) PUBMED 11829489 REFERENCE 2 (bases 1 to 353) AUTHORS Nakabayashi,K., Fernandez,B.A., Teshima,I., Shuman,C., Curry,C.J.R., Chitayat,D., Grebe,T., Ming,J., Oshimura,M., Meguro,M., Mitsuya,K., Deb-Rinker,P., Herbrick,J.-A., Weksberg,R. and Scherer,S.W. TITLE Direct Submission JOURNAL Submitted (04-JUL-2001) Genetics, Hospital for Sick Children, 555 University Avenue, Toronto, ON M5G 1X8, Canada FEATURES Location/Qualifiers source 1..353 /db_xref="H-InvDB:HIT000078968" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="7" /map="7p14" CDS 119..>353 /codon_start=1 /product="C7orf10 protein" /protein_id="AAL76418.1" /translation="MPSETHAMLATLARVAALRRTCLFSGRGGGRGLWTGRPQSDMNN IKPLEGVKILDLTRVLAGPFATMNLGDLGAEVIK" BASE COUNT 67 a 98 c 127 g 61 t ORIGIN 1 cccagcaggc gactagtgct cagccccgcc cggcgggggc ggggtctgcg gcgtccgtgg 61 gcgcccccca gtggcggcgg gtggcgccgc acggagttcg ccgcttgcac cgggaccgat 121 gccatctgag acgcacgcga tgctggcgac gctggcgagg gtggcagctc tgcgcagaac 181 ctgcctcttc tccggccggg gcggcgggag ggggctgtgg actggccgcc cgcagtcaga 241 tatgaacaat ataaagccat tggaaggggt aaaaattctg gatctaacaa gagtcctggc 301 gggacctttt gctactatga atttaggaga tcttggagca gaagttataa aag //