LOCUS AF330792 112 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens plectin isoform 1b (PLEC1) mRNA, partial cds, alternatively spliced. ACCESSION AF330792 VERSION AF330792.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 112) AUTHORS Kornacker,I., Andrae,K., Joergl,A., Fischer,I. and Wiche,G. TITLE Identification of the major epithelial isoform of plectin (plectin 1a): hemidesmosomal association and rescue potential in plectin-deficient keratinocytes JOURNAL Unpublished REFERENCE 2 (bases 1 to 112) AUTHORS Kornacker,I., Andrae,K., Joergl,A., Fischer,I., Zoerer,M. and Wiche,G. TITLE Direct Submission JOURNAL Submitted (20-DEC-2000) Institute of Biochemistry and Molecular Cell Biology, University of Vienna, Dr. Bohr-Gasse 9, Vienna A-1030, Austria FEATURES Location/Qualifiers source 1..112 /db_xref="H-InvDB:HIT000077659" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" gene 1..>112 /gene="PLEC1" CDS 1..>112 /gene="PLEC1" /note="PLEC1b; alternatively spliced" /codon_start=1 /product="plectin isoform 1b" /protein_id="AAL37483.1" /translation="MEPSGSLFPSLVVVGHVVTLAAVWHWRRGRRWAQDEQ" BASE COUNT 13 a 32 c 44 g 23 t ORIGIN 1 atggagccct cgggcagcct gtttccctcc ctggtggttg tgggtcacgt tgtcaccctg 61 gccgctgtgt ggcactggcg caggggacgt cggtgggcgc aggacgagca ag //