LOCUS       AF330791                 112 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens plectin isoform 1a (PLEC1) mRNA, partial cds,
            alternatively spliced.
ACCESSION   AF330791
VERSION     AF330791.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 112)
  AUTHORS   Kornacker,I., Andrae,K., Joergl,A., Fischer,I. and Wiche,G.
  TITLE     Identification of the major epithelial isoform of plectin (plectin
            1a): hemidesmosomal association and rescue potential in
            plectin-deficient keratinocytes
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 112)
  AUTHORS   Kornacker,I., Andrae,K., Joergl,A., Fischer,I., Zoerer,M. and
            Wiche,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2000) Institute of Biochemistry and Molecular
            Cell Biology, University of Vienna, Dr. Bohr-Gasse 9, Vienna
            A-1030, Austria
FEATURES             Location/Qualifiers
     source          1..112
                     /db_xref="H-InvDB:HIT000077658"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..>112
                     /gene="PLEC1"
     CDS             1..>112
                     /gene="PLEC1"
                     /note="PLEC1a; alternatively spliced"
                     /codon_start=1
                     /product="plectin isoform 1a"
                     /protein_id="AAL37482.1"
                     /translation="MSQQQLRVPQAEGLGRKRTSSEDNLYLAVLRASEGKK"
BASE COUNT           26 a           33 c           38 g           15 t
ORIGIN      
        1 atgtctcagc aacagctccg cgtgccgcag gccgagggcc tgggccgaaa gagaaccagc
       61 tcggaggaca acctgtacct ggctgtgctc agggcctctg agggcaagaa ag
//