LOCUS       AF326970                 327 bp    DNA     linear   HUM 14-JUL-2016
DEFINITION  Homo sapiens putative ionotropic glutamate receptor GRINL1B
            (GRINL1B) gene, partial cds.
ACCESSION   AF326970
VERSION     AF326970.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 327)
  AUTHORS   Mohan Raj,B.K., Roginski,R.S., Finkernagel,S.W. and Sciorra,L.J.
  TITLE     Assignment of GRINL1B, a glutamate receptor-like processed gene, to
            human chromosome 4q12 by in situ hybridization
  JOURNAL   Cytogenet. Cell Genet. 95 (3-4), 238-239 (2001)
   PUBMED   12063407
REFERENCE   2  (bases 1 to 327)
  AUTHORS   Roginski,R.S. and Mohan Raj,B.K.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2000) Anesthesiology, UMDNJ-Robert Wood Johnson
            Medical School, CAB Suite 3100/125 Paterson Street, New Brunswick,
            NJ 08901, USA
FEATURES             Location/Qualifiers
     source          1..327
                     /organism="Homo sapiens"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9606"
                     /chromosome="4"
                     /map="4q12"
                     /note="amplified as 390 bp PCR product at an annealing
                     temperature of 49C using primers 15424 and 13993 (see
                     GenBank Accession Number AF326772)"
     gene            <1..>327
                     /gene="GRINL1B"
     mRNA            <1..>327
                     /gene="GRINL1B"
                     /product="putative ionotropic glutamate receptor GRINL1B"
                     /note="corresponds to exons 20 and 21 of Homo sapiens
                     GRINL1A gene"
     CDS             <1..>327
                     /gene="GRINL1B"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Homo sapiens GRINL1A Gdown1 protein"
                     /codon_start=1
                     /product="putative ionotropic glutamate receptor GRINL1B"
                     /protein_id="AAG50023.1"
                     /translation="LPRGFEPQAPEDLAQRSLVELREMLKLQERLLRNEKFICKLPDK
                     GKKIFDSFAKLKAAIAECEEVRRKNELFHPVSLDCKLRQKAIAEVDVGTDKARNSDPI
                     LDTSSLV"
BASE COUNT           98 a           69 c           82 g           78 t
ORIGIN      
        1 ctgccccgcg gcttcgagcc ccaagctccc gaggacttgg cgcagcggag tttggtggag
       61 ctgcgggaaa tgttgaagct ccaggagaga cttttgcgca acgaaaaatt catttgcaaa
      121 ttgcccgaca aaggtaaaaa gatctttgac tcttttgcca aactgaaagc cgccattgca
      181 gaatgtgaag aagttagaag aaaaaatgaa ctgtttcacc ctgttagttt agactgtaag
      241 ctaaggcaaa aagcaattgc agaagttgat gtgggtacag ataaggcccg gaattctgac
      301 ccgatacttg atacttcatc actagtt
//