LOCUS AF326970 327 bp DNA linear HUM 14-JUL-2016 DEFINITION Homo sapiens putative ionotropic glutamate receptor GRINL1B (GRINL1B) gene, partial cds. ACCESSION AF326970 VERSION AF326970.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 327) AUTHORS Mohan Raj,B.K., Roginski,R.S., Finkernagel,S.W. and Sciorra,L.J. TITLE Assignment of GRINL1B, a glutamate receptor-like processed gene, to human chromosome 4q12 by in situ hybridization JOURNAL Cytogenet. Cell Genet. 95 (3-4), 238-239 (2001) PUBMED 12063407 REFERENCE 2 (bases 1 to 327) AUTHORS Roginski,R.S. and Mohan Raj,B.K. TITLE Direct Submission JOURNAL Submitted (07-DEC-2000) Anesthesiology, UMDNJ-Robert Wood Johnson Medical School, CAB Suite 3100/125 Paterson Street, New Brunswick, NJ 08901, USA FEATURES Location/Qualifiers source 1..327 /organism="Homo sapiens" /mol_type="genomic DNA" /db_xref="taxon:9606" /chromosome="4" /map="4q12" /note="amplified as 390 bp PCR product at an annealing temperature of 49C using primers 15424 and 13993 (see GenBank Accession Number AF326772)" gene <1..>327 /gene="GRINL1B" mRNA <1..>327 /gene="GRINL1B" /product="putative ionotropic glutamate receptor GRINL1B" /note="corresponds to exons 20 and 21 of Homo sapiens GRINL1A gene" CDS <1..>327 /gene="GRINL1B" /inference="non-experimental evidence, no additional details recorded" /note="similar to Homo sapiens GRINL1A Gdown1 protein" /codon_start=1 /product="putative ionotropic glutamate receptor GRINL1B" /protein_id="AAG50023.1" /translation="LPRGFEPQAPEDLAQRSLVELREMLKLQERLLRNEKFICKLPDK GKKIFDSFAKLKAAIAECEEVRRKNELFHPVSLDCKLRQKAIAEVDVGTDKARNSDPI LDTSSLV" BASE COUNT 98 a 69 c 82 g 78 t ORIGIN 1 ctgccccgcg gcttcgagcc ccaagctccc gaggacttgg cgcagcggag tttggtggag 61 ctgcgggaaa tgttgaagct ccaggagaga cttttgcgca acgaaaaatt catttgcaaa 121 ttgcccgaca aaggtaaaaa gatctttgac tcttttgcca aactgaaagc cgccattgca 181 gaatgtgaag aagttagaag aaaaaatgaa ctgtttcacc ctgttagttt agactgtaag 241 ctaaggcaaa aagcaattgc agaagttgat gtgggtacag ataaggcccg gaattctgac 301 ccgatacttg atacttcatc actagtt //