LOCUS AF285447 345 bp mRNA linear HUM 09-AUG-2001 DEFINITION Homo sapiens membrane protein DAP10 mRNA, complete cds. ACCESSION AF285447 VERSION AF285447.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 345) AUTHORS Wu,J., Song,Y., Bakker,A.B., Bauer,S., Spies,T., Lanier,L.L. and Phillips,J.H. TITLE An activating immunoreceptor complex formed by NKG2D and DAP10 JOURNAL Science 285 (5428), 730-732 (1999) PUBMED 10426994 REFERENCE 2 (bases 1 to 345) AUTHORS Yim,D., Jie,H.B., Sotiriadis,J., Kim,Y.S., Kim,K.S., Rothschild,M.F., Lanier,L.L. and Kim,Y.B. TITLE Molecular cloning and characterization of pig immunoreceptor DAP10 and NKG2D JOURNAL Immunogenetics 53 (3), 243-249 (2001) PUBMED 11398969 REFERENCE 3 (bases 1 to 345) AUTHORS Yim,D., Jie,H.-B., Sotiriadis,J., Kim,Y.-S. and Kim,Y.B. TITLE Direct Submission JOURNAL Submitted (07-JUL-2000) Microbiology & Immunology, Finch University of Health Sciences/The Chicago Medical School, 3333 Green Bay Road, North Chicago, IL 60064, USA FEATURES Location/Qualifiers source 1..345 /db_xref="H-InvDB:HIT000076277" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="19" /map="19q13.1" /cell_type="PBMC" CDS 32..313 /note="disulfide bonded homodimer" /codon_start=1 /product="membrane protein DAP10" /protein_id="AAG29425.1" /translation="MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGS LSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG" BASE COUNT 54 a 125 c 89 g 77 t ORIGIN 1 ctgccagacc cctgccagac cccagtccac catgatccat ctgggtcaca tcctcttcct 61 gcttttgctc ccagtggctg cagctcagac gaccccagga gagagatcat cactccctgc 121 cttttaccct ggcacttcag gctcctgttc cggatgtggg tccctctctc tgccgctcct 181 ggcaggcctc gtggctgctg atgcggtggc atcgctgctc atcgtggggg cggtgttcct 241 gtgcgcacgc ccacgccgca gccccgccca agaagatggc aaagtctaca tcaacatgcc 301 aggcaggggc tgaccctcct gcagcttgga cctttgactt ctgac //