LOCUS       AF285447                 345 bp    mRNA    linear   HUM 09-AUG-2001
DEFINITION  Homo sapiens membrane protein DAP10 mRNA, complete cds.
ACCESSION   AF285447
VERSION     AF285447.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 345)
  AUTHORS   Wu,J., Song,Y., Bakker,A.B., Bauer,S., Spies,T., Lanier,L.L. and
            Phillips,J.H.
  TITLE     An activating immunoreceptor complex formed by NKG2D and DAP10
  JOURNAL   Science 285 (5428), 730-732 (1999)
   PUBMED   10426994
REFERENCE   2  (bases 1 to 345)
  AUTHORS   Yim,D., Jie,H.B., Sotiriadis,J., Kim,Y.S., Kim,K.S.,
            Rothschild,M.F., Lanier,L.L. and Kim,Y.B.
  TITLE     Molecular cloning and characterization of pig immunoreceptor DAP10
            and NKG2D
  JOURNAL   Immunogenetics 53 (3), 243-249 (2001)
   PUBMED   11398969
REFERENCE   3  (bases 1 to 345)
  AUTHORS   Yim,D., Jie,H.-B., Sotiriadis,J., Kim,Y.-S. and Kim,Y.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUL-2000) Microbiology & Immunology, Finch University
            of Health Sciences/The Chicago Medical School, 3333 Green Bay Road,
            North Chicago, IL 60064, USA
FEATURES             Location/Qualifiers
     source          1..345
                     /db_xref="H-InvDB:HIT000076277"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19q13.1"
                     /cell_type="PBMC"
     CDS             32..313
                     /note="disulfide bonded homodimer"
                     /codon_start=1
                     /product="membrane protein DAP10"
                     /protein_id="AAG29425.1"
                     /translation="MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGS
                     LSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG"
BASE COUNT           54 a          125 c           89 g           77 t
ORIGIN      
        1 ctgccagacc cctgccagac cccagtccac catgatccat ctgggtcaca tcctcttcct
       61 gcttttgctc ccagtggctg cagctcagac gaccccagga gagagatcat cactccctgc
      121 cttttaccct ggcacttcag gctcctgttc cggatgtggg tccctctctc tgccgctcct
      181 ggcaggcctc gtggctgctg atgcggtggc atcgctgctc atcgtggggg cggtgttcct
      241 gtgcgcacgc ccacgccgca gccccgccca agaagatggc aaagtctaca tcaacatgcc
      301 aggcaggggc tgaccctcct gcagcttgga cctttgactt ctgac
//