LOCUS AF212842 1075 bp mRNA linear HUM 26-JUL-2016
DEFINITION Homo sapiens immunoglobulin-like transcript 11 protein (ILT11)
mRNA, partial cds.
ACCESSION AF212842
VERSION AF212842.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1075)
AUTHORS Wende,H., Volz,A. and Ziegler,A.
TITLE Extensive gene duplications and inversions characterize the human
Leukocyte Receptor Cluster
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1075)
AUTHORS Wende,H., Volz,A. and Ziegler,A.
TITLE Direct Submission
JOURNAL Submitted (07-DEC-1999) Institut fuer Immungenetik,
Universitaetsklinikum Charite Humboldt Universitaet, Spandauer Damm
130, Berlin 14050, Germany
FEATURES Location/Qualifiers
source 1..1075
/db_xref="H-InvDB:HIT000074065"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19q13.4"
/cell_type="peripheral blood lymphocytes"
gene <1..1075
/gene="ILT11"
CDS <1..734
/gene="ILT11"
/note="immunoglobulin superfamily; activating receptor"
/codon_start=3
/product="immunoglobulin-like transcript 11 protein"
/protein_id="AAF73849.1"
/translation="ISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKAG
FSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENV
TLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYG
SRRRILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGL
ILVVLGILIFQDWHSQRSPQAAAGR"
BASE COUNT 233 a 294 c 295 g 253 t
ORIGIN
1 tgatcagccg ggggaactct gtgaccatcc ggtgtcaggg gaccctggag gcccaggaat
61 accgtctggt taaagaggga agcccagaac cctgggacac acagaaccca ctggagccca
121 agaacaaggc cggattctcc atcccatcca tgacagagca ccatgcaggg agataccgct
181 gttactacta cagccctgca ggctggtcag agcccagcga ccccctggag ctggtggtga
241 caggattcta caacaaaccc accctctcag ccctgcccag tcctgtggtg acctcaggag
301 agaacgtgac cctccagtgt ggctcacggc tgagattcga caggttcatt ctgactgagg
361 aaggagacca caagctctcc tggaccttgg actcacagct gacccccagt gggcagttcc
421 aggccctgtt ccctgtgggc cctgtgaccc ccagccacag gtggatgctc agatgctatg
481 gctctcgcag gcgtatcctg caggtatggt cagaacccag tgacctcctg gagattccgg
541 tctcaggagc agctgataac ctcagtccgt cacaaaacaa gtctgactct gggactgcct
601 cacaccttca ggattacgca gtagagaatc tcatccgcat gggcatggcc ggcttgatcc
661 tggtggtcct tgggattctg atatttcagg attggcacag ccagagaagc ccccaagctg
721 cagctggaag gtgaacagaa gagagaacaa tgcaccattg aatgctggag ccttggaagc
781 gaatctgatg gtcctaggag gttcgggaag accatctgag gcctatgcca tctggactgt
841 ctgctggcaa tttctttttt tctttctttt cttttctttc tttttttttt tttttttttt
901 ttgagatgga gtcttgctct gtcaccaggc tggaatgcag tggcgcaatc tgggctcact
961 gcaacctccg cctctcgggt tcaagtgatt ctcctgcctc agcctctggc aatttctaga
1021 gggaggaatg ggtgtttgag tgcagagaca ctggtctggg gtgatccatg gagga
//