LOCUS AF199612 354 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens fibroblast growth factor homologous factor 2 isoform 1X+1W+1V (FHF-2) mRNA, partial cds. ACCESSION AF199612 VERSION AF199612.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 354) AUTHORS Munoz-Sanjuan,I., Smallwood,P.M. and Nathans,J. TITLE Isoform diversity among fibroblast growth factor homologous factors is generated by alternative promoter usage and differential splicing JOURNAL J. Biol. Chem. 275 (4), 2589-2597 (2000) PUBMED 10644718 REFERENCE 2 (bases 1 to 354) AUTHORS Munoz-Sanjuan,I., Smallwood,P.M. and Nathans,J. TITLE Direct Submission JOURNAL Submitted (29-OCT-1999) Molecular Biology and Genetics, Johns Hopkins University, 725 N. Wolfe Street/PCTB 805, Baltimore, MD 21205, USA FEATURES Location/Qualifiers source 1..354 /db_xref="H-InvDB:HIT000073725" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" gene 1..>354 /gene="FHF-2" CDS 225..>354 /gene="FHF-2" /note="hFHF-2(1X+1W+1V); similar to FGF; alternatively spliced" /codon_start=1 /product="fibroblast growth factor homologous factor 2 isoform 1X+1W+1V" /protein_id="AAF31399.1" /translation="MLRQDSIQSAELKKKESPFRAKCHEIFCCPLKQVHHKENTEPE" BASE COUNT 92 a 115 c 79 g 68 t ORIGIN 1 agacctcctt cccccccccc gccacccgac acctcctaat cctaaactcc ttatccaccc 61 caaccctccg ggaaggcagg agtttgcacc cttcgacacg ccgcgtgcaa agcaggggga 121 tctatcctcc ctggccacat gggcctttgg ctgatggaaa ggctgggctt tgaggaagct 181 gcatagttct ggatgacgcc ccccctggca cacaggaata cattatgtta cgacaagatt 241 ccatccaatc tgcggaatta aagaaaaaag agtccccctt tcgtgctaag tgtcacgaaa 301 tcttctgctg cccgctgaag caagtacacc acaaagagaa cacagagccg gaag //