LOCUS       AF199612                 354 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens fibroblast growth factor homologous factor 2 isoform
            1X+1W+1V (FHF-2) mRNA, partial cds.
ACCESSION   AF199612
VERSION     AF199612.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 354)
  AUTHORS   Munoz-Sanjuan,I., Smallwood,P.M. and Nathans,J.
  TITLE     Isoform diversity among fibroblast growth factor homologous factors
            is generated by alternative promoter usage and differential
            splicing
  JOURNAL   J. Biol. Chem. 275 (4), 2589-2597 (2000)
   PUBMED   10644718
REFERENCE   2  (bases 1 to 354)
  AUTHORS   Munoz-Sanjuan,I., Smallwood,P.M. and Nathans,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-1999) Molecular Biology and Genetics, Johns
            Hopkins University, 725 N. Wolfe Street/PCTB 805, Baltimore, MD
            21205, USA
FEATURES             Location/Qualifiers
     source          1..354
                     /db_xref="H-InvDB:HIT000073725"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..>354
                     /gene="FHF-2"
     CDS             225..>354
                     /gene="FHF-2"
                     /note="hFHF-2(1X+1W+1V); similar to FGF; alternatively
                     spliced"
                     /codon_start=1
                     /product="fibroblast growth factor homologous factor 2
                     isoform 1X+1W+1V"
                     /protein_id="AAF31399.1"
                     /translation="MLRQDSIQSAELKKKESPFRAKCHEIFCCPLKQVHHKENTEPE"
BASE COUNT           92 a          115 c           79 g           68 t
ORIGIN      
        1 agacctcctt cccccccccc gccacccgac acctcctaat cctaaactcc ttatccaccc
       61 caaccctccg ggaaggcagg agtttgcacc cttcgacacg ccgcgtgcaa agcaggggga
      121 tctatcctcc ctggccacat gggcctttgg ctgatggaaa ggctgggctt tgaggaagct
      181 gcatagttct ggatgacgcc ccccctggca cacaggaata cattatgtta cgacaagatt
      241 ccatccaatc tgcggaatta aagaaaaaag agtccccctt tcgtgctaag tgtcacgaaa
      301 tcttctgctg cccgctgaag caagtacacc acaaagagaa cacagagccg gaag
//