LOCUS AF190167 1303 bp mRNA linear HUM 13-MAR-2000
DEFINITION Homo sapiens membrane associated protein SLP-2 (HUSLP2) mRNA,
complete cds.
ACCESSION AF190167
VERSION AF190167.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1303)
AUTHORS Wang,Y. and Morrow,J.S.
TITLE Identification and characterization of human SLP-2, a novel
homologue of stomatin (band 7.2b) present in erythrocytes and other
tissues
JOURNAL J. Biol. Chem. 275 (11), 8062-8071 (2000)
PUBMED 10713127
REFERENCE 2 (bases 1 to 1303)
AUTHORS Wang,Y. and Morrow,J.S.
TITLE Direct Submission
JOURNAL Submitted (25-SEP-1999) Pathology, Yale Medical School, 310 Cedar
Street, New Haven, CT 06510, USA
FEATURES Location/Qualifiers
source 1..1303
/db_xref="H-InvDB:HIT000073230"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="9"
/tissue_type="heart muscle"
gene 1..1303
/gene="HUSLP2"
CDS 64..1134
/gene="HUSLP2"
/note="stomatin-like protein 2; widely distributed
peripheral membrane protein; similar to human erythrocyte
stomatin and MEC 1 of Caenorhabditis elegans; thought to
be involved in mechanoreception or lipid domain
organization"
/codon_start=1
/product="membrane associated protein SLP-2"
/protein_id="AAF09142.1"
/translation="MLARAARGTGALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQ
EAWVVERMGRFHRILEPGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQID
GVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDA
INQAADCWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVA
EGKKQAQILASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASL
TVAEQYVSAFSKLAKDSNTILLPSNPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSG
SSRDVQGTDASLDEELDRVKMS"
misc_feature 217
/gene="HUSLP2"
/note="alternative translation initiation site"
misc_feature 391
/gene="HUSLP2"
/note="alternative translation initiation site"
BASE COUNT 315 a 338 c 378 g 272 t
ORIGIN
1 ggcttctggg agcgaccgct ccgctcgtct cgttggttcc ggaggtcgct gcggcggtgg
61 gaaatgctgg cgcgcgcggc gcggggcact ggggcccttt tgctgagggg ctctctactg
121 gcttctggcc gcgctccgcg ccgcgcctcc tctggattgc cccgaaacac cgtggtactg
181 ttcgtgccgc agcaggaggc ctgggtggtg gagcgaatgg gccgattcca ccggatcctg
241 gagcctggtt tgaacatcct catccctgtg ttagaccgga tccgatatgt gcagagtctc
301 aaggaaattg tcatcaacgt gcctgagcag tcggctgtga ctctcgacaa tgtaactctg
361 caaatcgatg gagtccttta cctgcgcatc atggaccctt acaaggcaag ctacggtgtg
421 gaggaccctg agtatgccgt cacccagcta gctcaaacaa ccatgagatc agagctcggc
481 aaactctctc tggacaaagt cttccgggaa cgggagtccc tgaatgccag cattgtggat
541 gccatcaacc aagctgctga ctgctggggt atccgctgcc tccgttatga gatcaaggat
601 atccatgtgc caccccgggt gaaagagtct atgcagatgc aggtggaggc agagcggcgg
661 aaacgggcca cagttctaga gtctgagggg acccgagagt cggccatcaa tgtggcagaa
721 gggaagaaac aggcccagat cctggcctcc gaagcagaaa aggctgaaca gataaatcag
781 gcagcaggag aggccagtgc agttctggcg aaggccaagg ctaaagctga agctattcga
841 atcctggctg cagctctgac acaacataat ggagatgcag cagcttcact gactgtggcc
901 gagcagtatg tcagcgcgtt ctccaaactg gccaaggact ccaacactat cctactgccc
961 tccaaccctg gcgatgtcac cagcatggtg gctcaggcca tgggtgtata tggagccctc
1021 accaaagccc cagtgccagg gactccagac tcactctcca gtgggagcag cagagatgtc
1081 cagggtacag atgcaagtct tgatgaggaa cttgatcgag tcaagatgag ttagtggagc
1141 tgggcttggc cagggagtct ggggacaagg aagcagattt tcctgattct ggctctagct
1201 tccctgccaa gattttggtt tttatttttt tatttgaact ttagtcgtgt aataaactca
1261 ccagtggcaa acctgaaaaa aaaaaaaaaa aaaaaaaaaa aaa
//