LOCUS AF173860 159 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens NSAID-activated protein 1 NAG-1 mRNA, partial cds. ACCESSION AF173860 VERSION AF173860.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 159) AUTHORS Baek,S.J., Kim,K.S., Nixon,J.B., Wilson,L.C. and Eling,T.E. TITLE Cyclooxygenase inhibitors regulate the expression of a TGF-beta superfamily member that has proapoptotic and antitumorigenic activities JOURNAL Mol. Pharmacol. 59 (4), 901-908 (2001) PUBMED 11259636 REFERENCE 2 (bases 1 to 159) AUTHORS Baek,S.J. and Eling,T. TITLE Direct Submission JOURNAL Submitted (29-JUL-1999) Molecular Carcinogenesis, NIEHS, 111 TW Alexander Dr, Research Triangle Park, NC 27709, USA FEATURES Location/Qualifiers source 1..159 /db_xref="H-InvDB:HIT000072458" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="HCT-116" /cell_type="colorectal cancer cells" CDS <1..138 /codon_start=1 /product="NSAID-activated protein 1 NAG-1" /protein_id="AAF89834.1" /translation="LKPDTVPAPCCVPASYNPMVLIQKADTGVSLQTYDDLLAKDCHC I" BASE COUNT 33 a 54 c 40 g 32 t ORIGIN 1 ctgaagcccg acacggtgcc agcgccctgc tgcgtgcccg ccagctacaa tcccatggtg 61 ctcattcaaa aggccgacac cggggtgtcg ctccagacct atgatgactt gttagccaaa 121 gactgccact gcatatgagc agtcctggtc cttccactg //