LOCUS       AF173860                 159 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens NSAID-activated protein 1 NAG-1 mRNA, partial cds.
ACCESSION   AF173860
VERSION     AF173860.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 159)
  AUTHORS   Baek,S.J., Kim,K.S., Nixon,J.B., Wilson,L.C. and Eling,T.E.
  TITLE     Cyclooxygenase inhibitors regulate the expression of a TGF-beta
            superfamily member that has proapoptotic and antitumorigenic
            activities
  JOURNAL   Mol. Pharmacol. 59 (4), 901-908 (2001)
   PUBMED   11259636
REFERENCE   2  (bases 1 to 159)
  AUTHORS   Baek,S.J. and Eling,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUL-1999) Molecular Carcinogenesis, NIEHS, 111 TW
            Alexander Dr, Research Triangle Park, NC 27709, USA
FEATURES             Location/Qualifiers
     source          1..159
                     /db_xref="H-InvDB:HIT000072458"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="HCT-116"
                     /cell_type="colorectal cancer cells"
     CDS             <1..138
                     /codon_start=1
                     /product="NSAID-activated protein 1 NAG-1"
                     /protein_id="AAF89834.1"
                     /translation="LKPDTVPAPCCVPASYNPMVLIQKADTGVSLQTYDDLLAKDCHC
                     I"
BASE COUNT           33 a           54 c           40 g           32 t
ORIGIN      
        1 ctgaagcccg acacggtgcc agcgccctgc tgcgtgcccg ccagctacaa tcccatggtg
       61 ctcattcaaa aggccgacac cggggtgtcg ctccagacct atgatgactt gttagccaaa
      121 gactgccact gcatatgagc agtcctggtc cttccactg
//