LOCUS AF172852 858 bp mRNA linear HUM 01-MAY-2000 DEFINITION Homo sapiens calmodulin-like skin protein (CLSP) mRNA, complete cds. ACCESSION AF172852 VERSION AF172852.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 858) AUTHORS Mehul,B., Bernard,D., Simonetti,L., Bernard,M.A. and Schmidt,R. TITLE Identification and cloning of a new calmodulin-like protein from human epidermis JOURNAL J. Biol. Chem. 275 (17), 12841-12847 (2000) PUBMED 10777582 REFERENCE 2 (bases 1 to 858) AUTHORS Mehul,B., Bernard,D., Simonetti,L. and Schmidt,R. TITLE Direct Submission JOURNAL Submitted (27-JUL-1999) Life Science Research, L'Oreal, 90 rue du general Roguet, Clichy 92583, France FEATURES Location/Qualifiers source 1..858 /db_xref="H-InvDB:HIT000072441" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_type="keratinocyte" /tissue_type="skin" gene 1..858 /gene="CLSP" CDS 114..554 /gene="CLSP" /note="calcium binding protein" /codon_start=1 /product="calmodulin-like skin protein" /protein_id="AAF66821.1" /translation="MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNL SEAQLRKLISEVDSDGDGEISFQEFLTAARKARAGLEDLQVAFRAFDQDGDGHITVDE LRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE" BASE COUNT 155 a 267 c 301 g 135 t ORIGIN 1 aattcccgga tccctgcggc tgcctgcact ctggaccacg agctctgaga gcagcaggtt 61 gagggccggt gggcagcagc tcggaggctc cgcgaggtgc aggagacgca ggcatggccg 121 gtgagctgac tcctgaggag gaggcccagt acaaaaaggc tttctccgcg gttgacacgg 181 atggaaacgg caccatcaat gcccaggagc tgggcgcggc gctgaaggcc acgggcaaga 241 acctctcgga ggcccagcta aggaaactca tctccgaggt tgacagcgac ggcgacggcg 301 aaatcagctt ccaggagttc ctgacggcgg caaggaaggc cagggccggc ctggaggacc 361 tgcaggtcgc cttccgcgcc ttcgaccagg atggcgacgg ccacatcacc gtggacgagc 421 tcaggcgggc catggcgggg ctggggcagc cgctgccgca ggaggagctg gacgccatga 481 tccgcgaggc cgacgtggac caggacgggc gggtgaacta cgaggagttc gcgaggatgc 541 tcgcccagga gtgaggctcc ccgcctgtgt ccccctggct gcgctctgag ccttcagggc 601 caccgcccgc tgctgctttt gtgctgggac tctccgggga aacctggtcg gtggatggga 661 aactgcctcc ccctgggagg aaggctttgc gctccggggc ctggatgcgg cgccctcggg 721 ccgcctgcga gcccctctct gccttcagac cttgggcaga aggaggcctc cttgggcctg 781 gtcccccttt gccctgcagt ggaatgaggg ccccttaacc ccgcattgat ctaaataaag 841 gactgccgag ttccaaaa //