LOCUS       AF172852                 858 bp    mRNA    linear   HUM 01-MAY-2000
DEFINITION  Homo sapiens calmodulin-like skin protein (CLSP) mRNA, complete
            cds.
ACCESSION   AF172852
VERSION     AF172852.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 858)
  AUTHORS   Mehul,B., Bernard,D., Simonetti,L., Bernard,M.A. and Schmidt,R.
  TITLE     Identification and cloning of a new calmodulin-like protein from
            human epidermis
  JOURNAL   J. Biol. Chem. 275 (17), 12841-12847 (2000)
   PUBMED   10777582
REFERENCE   2  (bases 1 to 858)
  AUTHORS   Mehul,B., Bernard,D., Simonetti,L. and Schmidt,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JUL-1999) Life Science Research, L'Oreal, 90 rue du
            general Roguet, Clichy 92583, France
FEATURES             Location/Qualifiers
     source          1..858
                     /db_xref="H-InvDB:HIT000072441"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_type="keratinocyte"
                     /tissue_type="skin"
     gene            1..858
                     /gene="CLSP"
     CDS             114..554
                     /gene="CLSP"
                     /note="calcium binding protein"
                     /codon_start=1
                     /product="calmodulin-like skin protein"
                     /protein_id="AAF66821.1"
                     /translation="MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNL
                     SEAQLRKLISEVDSDGDGEISFQEFLTAARKARAGLEDLQVAFRAFDQDGDGHITVDE
                     LRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE"
BASE COUNT          155 a          267 c          301 g          135 t
ORIGIN      
        1 aattcccgga tccctgcggc tgcctgcact ctggaccacg agctctgaga gcagcaggtt
       61 gagggccggt gggcagcagc tcggaggctc cgcgaggtgc aggagacgca ggcatggccg
      121 gtgagctgac tcctgaggag gaggcccagt acaaaaaggc tttctccgcg gttgacacgg
      181 atggaaacgg caccatcaat gcccaggagc tgggcgcggc gctgaaggcc acgggcaaga
      241 acctctcgga ggcccagcta aggaaactca tctccgaggt tgacagcgac ggcgacggcg
      301 aaatcagctt ccaggagttc ctgacggcgg caaggaaggc cagggccggc ctggaggacc
      361 tgcaggtcgc cttccgcgcc ttcgaccagg atggcgacgg ccacatcacc gtggacgagc
      421 tcaggcgggc catggcgggg ctggggcagc cgctgccgca ggaggagctg gacgccatga
      481 tccgcgaggc cgacgtggac caggacgggc gggtgaacta cgaggagttc gcgaggatgc
      541 tcgcccagga gtgaggctcc ccgcctgtgt ccccctggct gcgctctgag ccttcagggc
      601 caccgcccgc tgctgctttt gtgctgggac tctccgggga aacctggtcg gtggatggga
      661 aactgcctcc ccctgggagg aaggctttgc gctccggggc ctggatgcgg cgccctcggg
      721 ccgcctgcga gcccctctct gccttcagac cttgggcaga aggaggcctc cttgggcctg
      781 gtcccccttt gccctgcagt ggaatgaggg ccccttaacc ccgcattgat ctaaataaag
      841 gactgccgag ttccaaaa
//