LOCUS AF169647 369 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens alternatively spliced dual specificity phosphatase inhibitor MK-STYX (MKSTYX) mRNA, partial cds. ACCESSION AF169647 VERSION AF169647.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 369) AUTHORS Dayton,M.A. and Blanchard,K.L. TITLE Differential expression of PTPase RNAs resulting from K562 differentiation induced by PMA JOURNAL Unpublished REFERENCE 2 (bases 1 to 369) AUTHORS Dayton,M.A. TITLE Direct Submission JOURNAL Submitted (16-JUL-1999) Medicine, Feist-Weiller Cancer Center, LSU Medical Center, 1501 Kings Highway, Shreveport, LA 71103-4228, USA FEATURES Location/Qualifiers source 1..369 /db_xref="H-InvDB:HIT000072348" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="K562" /cell_type="CML" /note="obtained from cells treated with PMA" gene <1..>369 /gene="MKSTYX" CDS <1..301 /gene="MKSTYX" /note="similar to the sequence presented in GenBank Accession Number AF069762" /codon_start=2 /product="alternatively spliced dual specificity phosphatase inhibitor MK-STYX" /protein_id="AAD53723.1" /translation="MPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVN VSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIGYQPQLCRHHSLPHA" BASE COUNT 97 a 100 c 83 g 89 t ORIGIN 1 gatgcctcag gaactggatg catttcagcc ataccccatt gaaatcgtgc cagggaaggt 61 cttcgttggc aatttcagtc aagcctgtga ccccaagatt cagaaggact tgaaaatcaa 121 agcccatgtc aatgtctcca tggatacagg gccctttttt gcaggcgatg ctgacaagct 181 tctgcacatc cggatagaag attccccgga agcccagatt cttcccttct tacgccacat 241 gtgtcacttc attgggtatc agccgcagtt gtgccgccat catagcctac ctcatgcata 301 gtaacgagca gaccttgcag aggtcctggg cctatgtcaa gaagtgcaaa aacaacatgt 361 gtccaaatc //