LOCUS       AF169647                 369 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens alternatively spliced dual specificity phosphatase
            inhibitor MK-STYX (MKSTYX) mRNA, partial cds.
ACCESSION   AF169647
VERSION     AF169647.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 369)
  AUTHORS   Dayton,M.A. and Blanchard,K.L.
  TITLE     Differential expression of PTPase RNAs resulting from K562
            differentiation induced by PMA
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 369)
  AUTHORS   Dayton,M.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JUL-1999) Medicine, Feist-Weiller Cancer Center, LSU
            Medical Center, 1501 Kings Highway, Shreveport, LA 71103-4228, USA
FEATURES             Location/Qualifiers
     source          1..369
                     /db_xref="H-InvDB:HIT000072348"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="K562"
                     /cell_type="CML"
                     /note="obtained from cells treated with PMA"
     gene            <1..>369
                     /gene="MKSTYX"
     CDS             <1..301
                     /gene="MKSTYX"
                     /note="similar to the sequence presented in GenBank
                     Accession Number AF069762"
                     /codon_start=2
                     /product="alternatively spliced dual specificity
                     phosphatase inhibitor MK-STYX"
                     /protein_id="AAD53723.1"
                     /translation="MPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVN
                     VSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIGYQPQLCRHHSLPHA"
BASE COUNT           97 a          100 c           83 g           89 t
ORIGIN      
        1 gatgcctcag gaactggatg catttcagcc ataccccatt gaaatcgtgc cagggaaggt
       61 cttcgttggc aatttcagtc aagcctgtga ccccaagatt cagaaggact tgaaaatcaa
      121 agcccatgtc aatgtctcca tggatacagg gccctttttt gcaggcgatg ctgacaagct
      181 tctgcacatc cggatagaag attccccgga agcccagatt cttcccttct tacgccacat
      241 gtgtcacttc attgggtatc agccgcagtt gtgccgccat catagcctac ctcatgcata
      301 gtaacgagca gaccttgcag aggtcctggg cctatgtcaa gaagtgcaaa aacaacatgt
      361 gtccaaatc
//