LOCUS AF122004 713 bp mRNA linear HUM 28-JUL-1999 DEFINITION Homo sapiens pilin-like transcription factor mRNA, complete cds. ACCESSION AF122004 VERSION AF122004.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 713) AUTHORS Escribano,J., Ortego,J. and Coca-Prados,M. TITLE Isolation and characterization of cell-specific cDNA clones from a subtractive library of the ocular ciliary body of a single normal human donor: transcription and synthesis of plasma proteins JOURNAL J. Biochem. 118 (5), 921-931 (1995) PUBMED 8749308 REFERENCE 2 (bases 1 to 713) AUTHORS Huang,W., Escribano,J., Sarfarazi,M. and Coca-Prados,M. TITLE Identification, expression and chromosome localization of a human gene encoding a novel protein with similarity to the pilB family of transcriptional factors (pilin) and to bacterial peptide methionine sulfoxide reductases JOURNAL Gene 233 (1-2), 233-240 (1999) PUBMED 10375640 REFERENCE 3 (bases 1 to 713) AUTHORS Coca-Prados,M. TITLE Direct Submission JOURNAL Submitted (19-JAN-1999) Ophthalmology and Visual Science, Yale University School of Medicine, 330 Cedar St, New Haven, CT 06520, USA FEATURES Location/Qualifiers source 1..713 /db_xref="H-InvDB:HIT000070343" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="10" /map="10p12; between WI-8535 and WI-4724" /clone="CBS-1" /tissue_type="ocular ciliary body" CDS 29..577 /codon_start=1 /product="pilin-like transcription factor" /protein_id="AAD38899.1" /translation="MARLLWLLRGLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLAT CELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEK KYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDG PGPNGQRFCINSVALKFKPRKH" BASE COUNT 176 a 181 c 203 g 153 t ORIGIN 1 gaattcggca cgagccggag cgggcgtcat ggcgcggctc ctctggttgc tccggggcct 61 gaccctcgga actgcgcctc ggcgggcggt gcggggccaa gcgggcggcg gcgggcccgg 121 caccgggccg ggactggggg aggcagggtc tcttgcaacg tgtgagctgc ctcttgccaa 181 gagtgagtgg caaaagaaac taaccccgga gcagttctac gtcacaagag aaaagggaac 241 ggaaccgcct ttcagtggga tctacctgaa taacaaggaa gcaggaatgt atcattgcgt 301 gtgctgcgac agtccactct tcagttctga gaaaaagtac tgctctggca ctgggtggcc 361 ttcgttttcc gaggctcatg gtacgtctgg ctctgatgaa agccacacag ggatcctgag 421 acgtctggat acctcgttag gatcagctcg cacagaggtt gtctgcaagc agtgtgaagc 481 tcatctaggt cacgtgtttc ctgatggacc tgggcccaat ggtcagaggt tttgcatcaa 541 cagtgtggct ttgaagttca aaccaaggaa acactgacca tcttcaagag tcccgttccc 601 ttgccacccc ttccacgtgc accctcaatt tcgcacaatt cacttgaatg acttgtttta 661 tttgcaataa aactgggctg aatttgcaaa aaaaaaaaaa aaaaaaaaaa aaa //