LOCUS       AF122004                 713 bp    mRNA    linear   HUM 28-JUL-1999
DEFINITION  Homo sapiens pilin-like transcription factor mRNA, complete cds.
ACCESSION   AF122004
VERSION     AF122004.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 713)
  AUTHORS   Escribano,J., Ortego,J. and Coca-Prados,M.
  TITLE     Isolation and characterization of cell-specific cDNA clones from a
            subtractive library of the ocular ciliary body of a single normal
            human donor: transcription and synthesis of plasma proteins
  JOURNAL   J. Biochem. 118 (5), 921-931 (1995)
   PUBMED   8749308
REFERENCE   2  (bases 1 to 713)
  AUTHORS   Huang,W., Escribano,J., Sarfarazi,M. and Coca-Prados,M.
  TITLE     Identification, expression and chromosome localization of a human
            gene encoding a novel protein with similarity to the pilB family of
            transcriptional factors (pilin) and to bacterial peptide methionine
            sulfoxide reductases
  JOURNAL   Gene 233 (1-2), 233-240 (1999)
   PUBMED   10375640
REFERENCE   3  (bases 1 to 713)
  AUTHORS   Coca-Prados,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-JAN-1999) Ophthalmology and Visual Science, Yale
            University School of Medicine, 330 Cedar St, New Haven, CT 06520,
            USA
FEATURES             Location/Qualifiers
     source          1..713
                     /db_xref="H-InvDB:HIT000070343"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10p12; between WI-8535 and WI-4724"
                     /clone="CBS-1"
                     /tissue_type="ocular ciliary body"
     CDS             29..577
                     /codon_start=1
                     /product="pilin-like transcription factor"
                     /protein_id="AAD38899.1"
                     /translation="MARLLWLLRGLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLAT
                     CELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEK
                     KYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDG
                     PGPNGQRFCINSVALKFKPRKH"
BASE COUNT          176 a          181 c          203 g          153 t
ORIGIN      
        1 gaattcggca cgagccggag cgggcgtcat ggcgcggctc ctctggttgc tccggggcct
       61 gaccctcgga actgcgcctc ggcgggcggt gcggggccaa gcgggcggcg gcgggcccgg
      121 caccgggccg ggactggggg aggcagggtc tcttgcaacg tgtgagctgc ctcttgccaa
      181 gagtgagtgg caaaagaaac taaccccgga gcagttctac gtcacaagag aaaagggaac
      241 ggaaccgcct ttcagtggga tctacctgaa taacaaggaa gcaggaatgt atcattgcgt
      301 gtgctgcgac agtccactct tcagttctga gaaaaagtac tgctctggca ctgggtggcc
      361 ttcgttttcc gaggctcatg gtacgtctgg ctctgatgaa agccacacag ggatcctgag
      421 acgtctggat acctcgttag gatcagctcg cacagaggtt gtctgcaagc agtgtgaagc
      481 tcatctaggt cacgtgtttc ctgatggacc tgggcccaat ggtcagaggt tttgcatcaa
      541 cagtgtggct ttgaagttca aaccaaggaa acactgacca tcttcaagag tcccgttccc
      601 ttgccacccc ttccacgtgc accctcaatt tcgcacaatt cacttgaatg acttgtttta
      661 tttgcaataa aactgggctg aatttgcaaa aaaaaaaaaa aaaaaaaaaa aaa
//