LOCUS AF117383 578 bp mRNA linear HUM 20-JAN-2000 DEFINITION Homo sapiens placental protein 13 (PP13) mRNA, complete cds. ACCESSION AF117383 VERSION AF117383.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 578) AUTHORS Bohn,H., Kraus,W. and Winckler,W. TITLE Purification and characterization of two new soluble placental tissue proteins (PP13 and PP17) JOURNAL Oncodev. Biol. Med. 4 (5), 343-350 (1983) PUBMED 6856484 REFERENCE 2 (bases 1 to 578) AUTHORS Than,N.G., Sumegi,B., Than,G.N., Berente,Z. and Bohn,H. TITLE Isolation and sequence analysis of a cDNA encoding human placental tissue protein 13 (PP13), a new lysophospholipase, homologue of human eosinophil Charcot-Leyden Crystal protein JOURNAL Placenta 20 (8), 703-710 (1999) PUBMED 10527825 REFERENCE 3 (bases 1 to 578) AUTHORS Than,N.G., Sumegi,B., Than,G.N. and Bohn,H. TITLE Direct Submission JOURNAL Submitted (01-JAN-1999) Department of Biochemistry, University Medical School of Pecs, 12 Szigeti Str., Pecs H-7624, Hungary FEATURES Location/Qualifiers source 1..578 /db_xref="H-InvDB:HIT000070105" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /tissue_type="placenta" gene 1..578 /gene="PP13" CDS 15..434 /gene="PP13" /note="soluble protein" /codon_start=1 /product="placental protein 13" /protein_id="AAF22001.1" /translation="MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDM DEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEI KVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN" BASE COUNT 159 a 135 c 124 g 160 t ORIGIN 1 caacacgagg aacaatgtct tctttacccg tgccatacaa actgcctgtg tctttgtctg 61 ttggttcctg cgtgataatc aaagggacac caatccactc ttttatcaat gacccacagc 121 tgcaggtgga tttctacact gacatggatg aggattcaga tattgccttc cgtttccgag 181 tgcactttgg caatcatgtg gtcatgaaca ggcgtgagtt tgggatatgg atgttggagg 241 agacaacaga ctacgtgccc tttgaggatg gcaaacaatt tgagctgtgc atctacgtac 301 attacaatga gtatgagata aaggtcaatg gcatacgcat ttacggcttt gtccatcgaa 361 tcccgccatc atttgtgaag atggtgcaag tgtcgagaga tatctccctg acctcagtgt 421 gtgtctgcaa ttgagggaga tgatcacact cctcattgtt gaggaatccc tctttctacc 481 tgaccatggg attcccagaa cctgctaaca gaataatccc tgctcacatt ttcccctaca 541 ctttgtcatt aaaacagcac caaaactcaa aaaaaaaa //