LOCUS       AF117383                 578 bp    mRNA    linear   HUM 20-JAN-2000
DEFINITION  Homo sapiens placental protein 13 (PP13) mRNA, complete cds.
ACCESSION   AF117383
VERSION     AF117383.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 578)
  AUTHORS   Bohn,H., Kraus,W. and Winckler,W.
  TITLE     Purification and characterization of two new soluble placental
            tissue proteins (PP13 and PP17)
  JOURNAL   Oncodev. Biol. Med. 4 (5), 343-350 (1983)
   PUBMED   6856484
REFERENCE   2  (bases 1 to 578)
  AUTHORS   Than,N.G., Sumegi,B., Than,G.N., Berente,Z. and Bohn,H.
  TITLE     Isolation and sequence analysis of a cDNA encoding human placental
            tissue protein 13 (PP13), a new lysophospholipase, homologue of
            human eosinophil Charcot-Leyden Crystal protein
  JOURNAL   Placenta 20 (8), 703-710 (1999)
   PUBMED   10527825
REFERENCE   3  (bases 1 to 578)
  AUTHORS   Than,N.G., Sumegi,B., Than,G.N. and Bohn,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JAN-1999) Department of Biochemistry, University
            Medical School of Pecs, 12 Szigeti Str., Pecs H-7624, Hungary
FEATURES             Location/Qualifiers
     source          1..578
                     /db_xref="H-InvDB:HIT000070105"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /tissue_type="placenta"
     gene            1..578
                     /gene="PP13"
     CDS             15..434
                     /gene="PP13"
                     /note="soluble protein"
                     /codon_start=1
                     /product="placental protein 13"
                     /protein_id="AAF22001.1"
                     /translation="MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDM
                     DEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEI
                     KVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN"
BASE COUNT          159 a          135 c          124 g          160 t
ORIGIN      
        1 caacacgagg aacaatgtct tctttacccg tgccatacaa actgcctgtg tctttgtctg
       61 ttggttcctg cgtgataatc aaagggacac caatccactc ttttatcaat gacccacagc
      121 tgcaggtgga tttctacact gacatggatg aggattcaga tattgccttc cgtttccgag
      181 tgcactttgg caatcatgtg gtcatgaaca ggcgtgagtt tgggatatgg atgttggagg
      241 agacaacaga ctacgtgccc tttgaggatg gcaaacaatt tgagctgtgc atctacgtac
      301 attacaatga gtatgagata aaggtcaatg gcatacgcat ttacggcttt gtccatcgaa
      361 tcccgccatc atttgtgaag atggtgcaag tgtcgagaga tatctccctg acctcagtgt
      421 gtgtctgcaa ttgagggaga tgatcacact cctcattgtt gaggaatccc tctttctacc
      481 tgaccatggg attcccagaa cctgctaaca gaataatccc tgctcacatt ttcccctaca
      541 ctttgtcatt aaaacagcac caaaactcaa aaaaaaaa
//