LOCUS AF103572 306 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens isolate donor Z clone Z51K immunoglobulin kappa light chain variable region mRNA, partial cds. ACCESSION AF103572 VERSION AF103572.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 306) AUTHORS de Wildt,R.M., Hoet,R.M., van Venrooij,W.J., Tomlinson,I.M. and Winter,G. TITLE Analysis of heavy and light chain pairings indicates that receptor editing shapes the human antibody repertoire JOURNAL J. Mol. Biol. 285 (3), 895-901 (1999) PUBMED 9887257 REFERENCE 2 (bases 1 to 306) AUTHORS de Wildt,R.M.T., Hoet,R.M.A., van Venrooij,W.J., Tomlinson,I.M. and Winter,G. TITLE Direct Submission JOURNAL Submitted (29-OCT-1998) Centre for Protein Engineering, MRC, Hills Road, Cambridge CB2 2QH, UK FEATURES Location/Qualifiers source 1..306 /organism="Homo sapiens" /mol_type="mRNA" /isolate="donor Z" /db_xref="taxon:9606" /clone="Z51K" /cell_type="B cell" /tissue_type="peripheral blood" /note="isolated from patient with systemic lupus erythematosus" CDS <1..>306 /codon_start=3 /product="immunoglobulin kappa light chain variable region" /protein_id="AAD16632.1" /translation="VSLGERATINCKSSQSVLYSSNNNNYLAWYQQKSGQPPKLLIYW ASTRESGVPDRFSGSGSATDFTLTISSLQAEDVALYFCQQYFTFPLTFGGGTKVEMR" V_region <1..>306 BASE COUNT 71 a 82 c 77 g 76 t ORIGIN 1 ctgtgtctct gggcgagagg gccaccatca actgcaagtc cagccagagt gttttgtaca 61 gctcgaacaa taataactac ttagcttggt accagcagaa atcaggacag cctcctaaac 121 tgctcattta ctgggcttct acccgggaat ccggggtccc tgaccgattc agtggcagcg 181 ggtctgcgac agatttcact ctcaccatca gcagcctgca ggctgaagat gtggcacttt 241 atttctgtca gcaatatttt acttttccgc tcactttcgg cggcgggacc aaggtggaga 301 tgagac //