LOCUS       AF103572                 306 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens isolate donor Z clone Z51K immunoglobulin kappa light
            chain variable region mRNA, partial cds.
ACCESSION   AF103572
VERSION     AF103572.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 306)
  AUTHORS   de Wildt,R.M., Hoet,R.M., van Venrooij,W.J., Tomlinson,I.M. and
            Winter,G.
  TITLE     Analysis of heavy and light chain pairings indicates that receptor
            editing shapes the human antibody repertoire
  JOURNAL   J. Mol. Biol. 285 (3), 895-901 (1999)
   PUBMED   9887257
REFERENCE   2  (bases 1 to 306)
  AUTHORS   de Wildt,R.M.T., Hoet,R.M.A., van Venrooij,W.J., Tomlinson,I.M. and
            Winter,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-1998) Centre for Protein Engineering, MRC, Hills
            Road, Cambridge CB2 2QH, UK
FEATURES             Location/Qualifiers
     source          1..306
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="donor Z"
                     /db_xref="taxon:9606"
                     /clone="Z51K"
                     /cell_type="B cell"
                     /tissue_type="peripheral blood"
                     /note="isolated from patient with systemic lupus
                     erythematosus"
     CDS             <1..>306
                     /codon_start=3
                     /product="immunoglobulin kappa light chain variable
                     region"
                     /protein_id="AAD16632.1"
                     /translation="VSLGERATINCKSSQSVLYSSNNNNYLAWYQQKSGQPPKLLIYW
                     ASTRESGVPDRFSGSGSATDFTLTISSLQAEDVALYFCQQYFTFPLTFGGGTKVEMR"
     V_region        <1..>306
BASE COUNT           71 a           82 c           77 g           76 t
ORIGIN      
        1 ctgtgtctct gggcgagagg gccaccatca actgcaagtc cagccagagt gttttgtaca
       61 gctcgaacaa taataactac ttagcttggt accagcagaa atcaggacag cctcctaaac
      121 tgctcattta ctgggcttct acccgggaat ccggggtccc tgaccgattc agtggcagcg
      181 ggtctgcgac agatttcact ctcaccatca gcagcctgca ggctgaagat gtggcacttt
      241 atttctgtca gcaatatttt acttttccgc tcactttcgg cggcgggacc aaggtggaga
      301 tgagac
//