LOCUS AF103563 321 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens isolate donor Z clone Z31K immunoglobulin kappa light chain variable region mRNA, partial cds. ACCESSION AF103563 VERSION AF103563.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 321) AUTHORS de Wildt,R.M., Hoet,R.M., van Venrooij,W.J., Tomlinson,I.M. and Winter,G. TITLE Analysis of heavy and light chain pairings indicates that receptor editing shapes the human antibody repertoire JOURNAL J. Mol. Biol. 285 (3), 895-901 (1999) PUBMED 9887257 REFERENCE 2 (bases 1 to 321) AUTHORS de Wildt,R.M.T., Hoet,R.M.A., van Venrooij,W.J., Tomlinson,I.M. and Winter,G. TITLE Direct Submission JOURNAL Submitted (29-OCT-1998) Centre for Protein Engineering, MRC, Hills Road, Cambridge CB2 2QH, UK FEATURES Location/Qualifiers source 1..321 /organism="Homo sapiens" /mol_type="mRNA" /isolate="donor Z" /db_xref="taxon:9606" /clone="Z31K" /cell_type="B cell" /tissue_type="peripheral blood" /note="isolated from patient with systemic lupus erythematosus" CDS <1..>321 /codon_start=3 /product="immunoglobulin kappa light chain variable region" /protein_id="AAD16623.1" /translation="SLGERASINCKSSQSVLYSSNSKNYLAWYQQKPGQPPRLLIYWA STRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYFCQQYYSSPLTFGGGTTVEIKRT GQHH" V_region <1..>321 BASE COUNT 80 a 86 c 82 g 73 t ORIGIN 1 tgtctctggg cgagagggcc tccatcaact gcaagtccag ccagagtgtt ctatacagct 61 ccaacagtaa gaactactta gcttggtatc aacaaaaacc aggacagcct ccaaggctgc 121 tcatttactg ggcatctacc cgggaatccg gggtccctga ccgattcagt ggcagcgggt 181 ctgggacaga tttcactctc accatcagca gcctgcaggc tgaagatgtg gcagtttatt 241 tctgtcagca atattatagt agtcctctca ctttcggcgg agggaccacg gtggagatca 301 aacgaactgg gcagcaccat t //