LOCUS AF103542 301 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens isolate donor Z clone Z110K immunoglobulin kappa light chain variable region mRNA, partial cds. ACCESSION AF103542 VERSION AF103542.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 301) AUTHORS de Wildt,R.M., Hoet,R.M., van Venrooij,W.J., Tomlinson,I.M. and Winter,G. TITLE Analysis of heavy and light chain pairings indicates that receptor editing shapes the human antibody repertoire JOURNAL J. Mol. Biol. 285 (3), 895-901 (1999) PUBMED 9887257 REFERENCE 2 (bases 1 to 301) AUTHORS de Wildt,R.M.T., Hoet,R.M.A., van Venrooij,W.J., Tomlinson,I.M. and Winter,G. TITLE Direct Submission JOURNAL Submitted (29-OCT-1998) Centre for Protein Engineering, MRC, Hills Road, Cambridge CB2 2QH, UK FEATURES Location/Qualifiers source 1..301 /db_xref="H-InvDB:HIT000069195" /organism="Homo sapiens" /mol_type="mRNA" /isolate="donor Z" /db_xref="taxon:9606" /clone="Z110K" /cell_type="B cell" /tissue_type="peripheral blood" /note="isolated from patient with systemic lupus erythematosus" CDS <1..>301 /codon_start=3 /product="immunoglobulin kappa light chain variable region" /protein_id="AAD16602.1" /translation="DSLAVSLGERATINCKSSQSVLGSSNNQNYLAWYQQKPGQPPKL LIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNTPWTFGQGT" V_region <1..>301 BASE COUNT 72 a 83 c 78 g 68 t ORIGIN 1 cagactccct ggctgtgtct ctgggcgaga gggccaccat caactgcaag tccagccaga 61 gtgttttagg cagttccaac aatcagaact acttagcttg gtaccagcag aaaccaggac 121 agcctcctaa gctgctcatt tactgggcat ctacccggga atccggggtc cctgaccgat 181 tcagtggcag cgggtctggg acagatttca ctctcaccat cagcagcctg caggctgaag 241 atgtggcagt ttattactgt cagcaatatt ataatactcc gtggacgttc ggccaaggga 301 c //