LOCUS       AF103542                 301 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens isolate donor Z clone Z110K immunoglobulin kappa light
            chain variable region mRNA, partial cds.
ACCESSION   AF103542
VERSION     AF103542.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 301)
  AUTHORS   de Wildt,R.M., Hoet,R.M., van Venrooij,W.J., Tomlinson,I.M. and
            Winter,G.
  TITLE     Analysis of heavy and light chain pairings indicates that receptor
            editing shapes the human antibody repertoire
  JOURNAL   J. Mol. Biol. 285 (3), 895-901 (1999)
   PUBMED   9887257
REFERENCE   2  (bases 1 to 301)
  AUTHORS   de Wildt,R.M.T., Hoet,R.M.A., van Venrooij,W.J., Tomlinson,I.M. and
            Winter,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-1998) Centre for Protein Engineering, MRC, Hills
            Road, Cambridge CB2 2QH, UK
FEATURES             Location/Qualifiers
     source          1..301
                     /db_xref="H-InvDB:HIT000069195"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="donor Z"
                     /db_xref="taxon:9606"
                     /clone="Z110K"
                     /cell_type="B cell"
                     /tissue_type="peripheral blood"
                     /note="isolated from patient with systemic lupus
                     erythematosus"
     CDS             <1..>301
                     /codon_start=3
                     /product="immunoglobulin kappa light chain variable
                     region"
                     /protein_id="AAD16602.1"
                     /translation="DSLAVSLGERATINCKSSQSVLGSSNNQNYLAWYQQKPGQPPKL
                     LIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNTPWTFGQGT"
     V_region        <1..>301
BASE COUNT           72 a           83 c           78 g           68 t
ORIGIN      
        1 cagactccct ggctgtgtct ctgggcgaga gggccaccat caactgcaag tccagccaga
       61 gtgttttagg cagttccaac aatcagaact acttagcttg gtaccagcag aaaccaggac
      121 agcctcctaa gctgctcatt tactgggcat ctacccggga atccggggtc cctgaccgat
      181 tcagtggcag cgggtctggg acagatttca ctctcaccat cagcagcctg caggctgaag
      241 atgtggcagt ttattactgt cagcaatatt ataatactcc gtggacgttc ggccaaggga
      301 c
//