LOCUS AF103402 322 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens isolate donor D clone D42K immunoglobulin kappa light chain variable region mRNA, partial cds. ACCESSION AF103402 VERSION AF103402.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 322) AUTHORS de Wildt,R.M., Hoet,R.M., van Venrooij,W.J., Tomlinson,I.M. and Winter,G. TITLE Analysis of heavy and light chain pairings indicates that receptor editing shapes the human antibody repertoire JOURNAL J. Mol. Biol. 285 (3), 895-901 (1999) PUBMED 9887257 REFERENCE 2 (bases 1 to 322) AUTHORS de Wildt,R.M.T., Hoet,R.M.A., van Venrooij,W.J., Tomlinson,I.M. and Winter,G. TITLE Direct Submission JOURNAL Submitted (29-OCT-1998) Centre for Protein Engineering, MRC, Hills Road, Cambridge CB2 2QH, UK FEATURES Location/Qualifiers source 1..322 /organism="Homo sapiens" /mol_type="mRNA" /isolate="donor D" /db_xref="taxon:9606" /clone="D42K" /cell_type="B cell" /tissue_type="peripheral blood" /note="isolated from patient with systemic lupus erythematosus" CDS <1..>322 /codon_start=1 /product="immunoglobulin kappa light chain variable region" /protein_id="AAD16573.1" /translation="AVSLGERATINCKSSQSVLHSSNNKNYLAWYQQKPGQPPKLLIK WAFTRDSGVPDRFSGSGSGTDFTLTITSLQAEDVAVYYCQQYYGLPLTFGGGTKVEIK RTVPA" V_region <1..>322 BASE COUNT 77 a 88 c 84 g 73 t ORIGIN 1 gctgtgtctc tgggcgagag ggccaccatc aactgcaagt ccagtcagag tgttttacac 61 agctccaaca ataagaacta cttagcttgg taccagcaga aaccaggcca gcctcctaag 121 ctgctcatta agtgggcatt tacccgggac tccggggtcc ctgaccgatt cagtggcagc 181 gggtctggga cagatttcac tctcaccatc accagcctgc aggcggaaga tgtggcagtt 241 tattactgtc agcaatatta tggtcttcct ctcactttcg gcggagggac caaggtggag 301 atcaaacgaa ctgtgcctgc ac //